Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit(PPP1CB)

Code CSB-EP018504HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P62140
Relevance Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Research Area Signal Transduction
Source E.coli
Gene Names PPP1CB
Protein Names Recommended name: Serine/threonine-protein phosphatase PP1-beta catalytic subunit Short name= PP-1B Short name= PPP1CD EC= 3.1.3.16 EC= 3.1.3.53
Expression Region 2-327aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 41.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective
Involvement in disease Noonan syndrome-like disorder with loose anagen hair 2 (NSLH2)
Subcellular Location Cytoplasm, Nucleus, Nucleus, nucleoplasm, Nucleus, nucleolus
Protein Families PPP phosphatase family, PP-1 subfamily
Database Links

HGNC: 9282

OMIM: 600590

KEGG: hsa:5500

STRING: 9606.ENSP00000296122

UniGene: Hs.702907

Pathway cAMP signaling pathway
Hippo signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Vascular smooth muscle contraction
Cellular senescence
cGMP-PKG signaling pathway
Insulin signaling pathway

Related Products

PPP1CB Antibodies

PPP1CB Antibodies for Homo sapiens (Human)

PPP1CB Antibodies for Human

PPP1CB Proteins

PPP1CB Proteins for Homo sapiens (Human)

PPP1CB ELISA Kit

PPP1CB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.