Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP018504HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P62140 |
| Relevance | Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | PPP1CB |
| Protein Names | Recommended name: Serine/threonine-protein phosphatase PP1-beta catalytic subunit Short name= PP-1B Short name= PPP1CD EC= 3.1.3.16 EC= 3.1.3.53 |
| Expression Region | 2-327aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 41.1kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective |
| Involvement in disease | Noonan syndrome-like disorder with loose anagen hair 2 (NSLH2) |
| Subcellular Location | Cytoplasm, Nucleus, Nucleus, nucleoplasm, Nucleus, nucleolus |
| Protein Families | PPP phosphatase family, PP-1 subfamily |
| Database Links |
HGNC: 9282 OMIM: 600590 KEGG: hsa:5500 STRING: 9606.ENSP00000296122 UniGene: Hs.702907 |
| Pathway |
cAMP signaling pathway
Hippo signaling pathway Focal adhesion Regulation of actin cytoskeleton Vascular smooth muscle contraction Cellular senescence cGMP-PKG signaling pathway Insulin signaling pathway |
PPP1CB Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA018504GA01HU | PPP1CB Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA959704 | PPP1CB Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA559752 | PPP1CB Antibody | Human,Mouse,Rat | ELISA,IHC |
PPP1CB Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA018504LA01HU | PPP1CB Antibody | Human | ELISA, WB, IHC |
| CSB-PA018504LD01HU | PPP1CB Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA018504LC01HU | PPP1CB Antibody, FITC conjugated | Human | ELISA |
| CSB-PA018504LB01HU | PPP1CB Antibody, HRP conjugated | Human | ELISA |
PPP1CB Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP018504HU CSB-BP018504HU CSB-MP018504HU |
Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit(PPP1CB) | Yeast Baculovirus Mammalian cell |
PPP1CB ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL018504HU | Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit(PPP1CB) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 3.9 pg/mL |
Recombinant Human ATP synthase subunit delta, mitochondrial(ATP5D)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Peroxisome prolifeRator-activated receptor gamma(PPARG)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Insulin-like growth factor-binding protein 1(Igfbp1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Glycogen synthase kinase-3 beta(GSK3B)
Express system: Yeast
Species: Homo sapiens (Human)
