Recombinant Human Sodium/potassium-transporting ATPase subunit alpha-3 (ATP1A3), partial, Biotinylated

Code CSB-EP002324HU-B
Abbreviation Recombinant Human ATP1A3 protein, partial, Biotinylated
MSDS
Size $308
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Na+/K+ ATPase alphaIII subunit;Sodium pump subunit alpha-3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3-60aa
Target Protein Sequence
DKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.5 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.
Gene References into Functions
  1. sequencing analysis of ATP1A3 gene was performed, showing a trinucleotide deletion c.2266_2268delGAC p.(D756del) (NM_001256214). PMID: 29395663
  2. we describe 7 patients with 6 different de novo ATP1A3 mutations...which confirm that ATP1A3-related neurological disorders make up a phenotypic continuum rather than overlapping syndromes PMID: 29396171
  3. Patients with R756L and R756C protein variants display more prominent ataxia, overlapping with the relapsing encephalopathy with cerebellar ataxia syndrome. PMID: 28647130
  4. Germline mosaicism for ATP1A3 mutations is a likely explanation for familial recurrence and should be considered during recurrence risk counseling for families of children with ATP1A3-related disorders. PMID: 27726050
  5. conclude that the de novo G316S mutation in ATP1A3 likely causes or contributes to patient symptoms. More broadly, we conclude that, for conserved genes, it is possible to rapidly and easily model human diseases in C. elegans using CRIPSR/Cas9 genome editing PMID: 27936181
  6. study confirms that the specific c.2452G>A mutation in the ATP1A3 gene is associated with the CAPOS syndrome in pedigrees of different ethnic backgrounds; also the first report showing the co-occurrence of hemiplegic migraine and CAPOS syndrome in a patient with ATP1A3 mutations PMID: 26453127
  7. Our results, demonstrate a highly variable clinical phenotype in patients with alternating hemiplegia of childhood that correlates with certain mutations and possibly clusters within the ATPase Na+/K+ transporting subunit alpha 3 gene. PMID: 26410222
  8. nvestigated a large dystonia family from New Zealand in which only females were affected; found a novel, likely disease-causing, three base-pair deletion (c.443_445delGAG, p.Ser148del) in ATP1A3 in this family by combining genome and exome sequencing PMID: 25359261
  9. Common variants of ATP1A3 were associated with susceptibility to generalized epilepsy in a Chinese population. PMID: 26003227
  10. This study further expands the number and spectrum of ATP1A3 mutations associated with Alternating Hemiplegia of Childhood and confirms a more deleterious effect of the E815K mutation on selected neurologic outcomes. PMID: 25996915
  11. This study demonstrated that the ATP1A3 protein was altered in auditory cortex patient with schizophreia. PMID: 25433904
  12. interactions of alpha3-NKA with extracellular alpha-syn assemblies reduce its pumping activity as its mutations in RDP/AHC. PMID: 26323479
  13. Alternating hemiplegia of childhood is a rare disorder caused by de novo mutations in the ATP1A3 gene, expressed in neurons and cardiomyocytes. PMID: 26297560
  14. The amylospheroids target is neuron-specific Na(+)/K(+)-ATPase alpha3 subunit (NAKalpha3). PMID: 26224839
  15. Review of the phenotypic spectrum of ATP1A3-related neurological disorders in children PMID: 25447930
  16. The rsults of this study indicate the mutations cause severe phenotypesd of ATP1A3-related disorder spectrum that include catastrophic early life epilepsy, episodic apnea, and postnatal microcephaly. PMID: 25656163
  17. This study identified ATP1A3 mutations in 10 alternating hemiplegia of childhood and response to Ketogenic Diet treatment. PMID: 24996492
  18. De novo mutations were detected in 100% of 16 AHC patients. The most frequent mutation was G2401A in 8 patients (50%) followed by G2443A in 3 patients, G2893A in 2, and C2781G, G2893C and C2411T in one patient each. PMID: 24768197
  19. ATP1A3 is the major pathogenic gene of AHC in Chinese patients. PMID: 24842602
  20. Impaired cognitive function may be a manifestation of ATP1A3 mutation and Rapid-onset dystonia-parkinsonism PMID: 24436111
  21. study shows that an allelic mutation in ATP1A3 produces CAPOS syndrome PMID: 24468074
  22. Patients in a Danish pediatric cohort with alternating hemiplegia of childhood reveal no detectable ATP1A3 mutation and are less severely affected. PMID: 24100174
  23. This reiew showed that ATP1A4 mutation association with rapid-onset dystonia parkinsonism and Alternating hemiplegia of childhood. PMID: 24739246
  24. the ATP1A3mutation is not the sole determinant of clinical expression, implying that genetic, epigenetic, and environmental factors play an important role in the clinical expression of ATP1A3-related disease PMID: 23483595
  25. patients with alternating hemiplegia of childhood and rapid-onset dystonia-parkinsonism constitute clinical prototypes in a continuous phenotypic spectrum of ATP1A3-related disorders. PMID: 24523486
  26. The Glu815Lys genotype of ATP1A3 appears to be associated with the most severe phenotype of alternating hemiplegia of childhood. PMID: 24431296
  27. The episodic dyskinesia as a clinical hallmark, was recently found to be caused by heterozygous de novo mutations in the ATP1A3 gene. PMID: 23963607
  28. Our results provide validation for missense mutations in Na+,K+-ATPase alpha3 as a cause of Alternating hemiplegia of childhood, and highlight Myshkin mice as a starting point for the exploration of disease mechanisms and novel treatments in AHC. PMID: 23527305
  29. Heterozygous de novo mutations of ATP1A3 were identified in all Japanese patients with alternating hemiplegia of childhood PMID: 23409136
  30. rapid-onset dystonia-Parkinsonism (RDP) is described in children under age 4 years; study reports new clinical features of delayed motor development, hypotonia, and ataxia in 2 young children with mutations (R756H and D923N) in the ATP1A3 gene PMID: 22924536
  31. This work identifies de novo ATP1A3 mutations as the primary cause of alternating hemiplagia of childhood and offers insight into disease pathophysiology by expanding the spectrum of phenotypes associated with mutations in ATP1A3. PMID: 22842232
  32. Mutation analysis of the ATP1A3 gene in patients who met clinical criteria. PMID: 22850527
  33. An interaction between agrin and alpha3-Na+K+-ATPase is of functional importance in newly generated neurons in the adult olfactory bulb. PMID: 22423096
  34. A common ATP1A3 genomic variation may represent a susceptibility factor for the risk for antipsychotic-induced parkinsonism in an allele-dependent manner. PMID: 21072501
  35. Retinoschisin, the protein involved in the pathogenesis of X-linked juvenile retinoschisis, membrane association is severely impaired in the absence of ATP1A3 and ATP1B2. PMID: 21196491
  36. Na+/K+-ATPase alpha3 might serve as a therapeutic target for bufalin, and its expression status may help predict sensitivity of hepatocellular carcinoma cells to bufalin treatment. PMID: 21181095
  37. Rapid-onset dystonia parkinsonism mutation of the neuron-specific alpha3-isoform of Na(+), K(+)-ATPase is associated with a selective defect in the handling of Na(+) PMID: 20576601
  38. abundance in placenta and myometrium was significantly decreased in women in active labor PMID: 12634653
  39. These mutations impair enzyme activity or stability. This finding implicates the Na+/K+ pump, a crucial protein responsible for the electrochemical gradient across the cell membrane, in dystonia and parkinsonism. PMID: 15260953
  40. A minimal promoter region of approx. 100 bp upstream of the major transcription start site contains the cognate DNA sites for the transcription factors Sp1/3/4, NF-Y,& a half-CRE (cAMP-response element)-like element that binds a still unknown protein. PMID: 15462673
  41. The Irish rapid-onset dystonia-Parkinsonism kindred. All affected patients tested had a missense mutation in the Na(+)/K(+) -ATPase alpha3 subunit (ATP1A3). PMID: 17516473
  42. We report a 38-year-old Korean man with sporadic rapid-onset dystonia-parkinsonism (RDP), who had a Thr 618 Met mutation in the Na(+)/K(+)-ATPase alpha3 subunit gene (ATP1A3). PMID: 17595045
  43. The human sural nerve shows a specific localization of the Na+,K+-ATPase alpha3-isoform in the Schmidt-Lanterman incisures of Schwann cells in addition to its localization in axonal membranes. PMID: 18184478
  44. Several mutations in alpha3 have been identified that link the specific function of the Na+,K+-ATPase to the pathophysiology of neurological diseases such as rapid-onset dystonia parkinsonism and familial hemiplegic migraine type 2 PMID: 18957371
  45. Significant nominal association with bipolar disooder was observed for single Single Nucleotide Polymorphism(rs919390) in the gene of ATP1A3. PMID: 19058785
  46. C-terminal of ATP1A3 plays a crucial role in regulating the sodium affinity in the pathophysiology of rapid-onset dystonia-parkinsonism. PMID: 19351654

Show More

Hide All

Involvement in disease
Dystonia 12 (DYT12); Alternating hemiplegia of childhood 2 (AHC2); Cerebellar ataxia, areflexia, pes cavus, optic atrophy, and sensorineural hearing loss (CAPOS)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIC subfamily
Database Links

HGNC: 801

OMIM: 128235

KEGG: hsa:478

STRING: 9606.ENSP00000302397

UniGene: Hs.515427

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*