Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial

Code CSB-EP004931HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P07766
Relevance The CD3 complex mediates signal transduction, resulting in T-cell activation and proliferation. Required for normal immune responses (PubMed:15546002, PubMed:8490660).
Storage Buffer Tris-based buffer,50% glycerol
Alias T-cell surface antigen T3/Leu-4 epsilon chain;CD_antigen: CD3e
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Research Area Immunology
Source E.coli
Gene Names CD3E
Protein Names Recommended name: T-cell surface glycoprotein CD3 epsilon chainAlternative name(s): T-cell surface antigen T3/Leu-4 epsilon chain CD_antigen= CD3e
Expression Region 23-126aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.8
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways
Involvement in disease Immunodeficiency 18 (IMD18)
Subcellular Location Cell membrane, Single-pass type I membrane protein
Database Links

HGNC: 1674

OMIM: 186830

KEGG: hsa:916

STRING: 9606.ENSP00000354566

UniGene: Hs.3003

Pathway Hematopoietic cell lineage
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

CD3E Antibodies

CD3E Antibodies for Human

CD3E Antibodies for Homo sapiens (Human)

CD3E Proteins

CD3E Proteins for Homo sapiens (Human)

CD3E ELISA Kit

CD3E ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.