Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CD3E

Uniprot No.

P07766

Research Area

Immunology

Alternative Names

CD3 epsilon; CD3e; CD3e antigen; CD3e antigen epsilon polypeptide (TiT3 complex); CD3E antigen epsilon polypeptide; CD3E antigen, epsilon subunit; CD3e molecule epsilon; CD3e molecule, epsilon (CD3 TCR complex); CD3e molecule, epsilon (CD3-TCR complex); CD3E_HUMAN; IMD18; T cell antigen receptor complex epsilon subunit of T3; T cell surface antigen T3/Leu 4 epsilon chain; T cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 epsilon chain; T3E; TCRE

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

23-207aa

Target Protein Sequence

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

47.7kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The process of expressing the recombinant human CD3E protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 23-207aa of the human CD3E protein and N-terminal GST tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal GST-tagged recombinant CD3E protein was obtained. This recombinant CD3E protein is characterized by high purity (>90%, SDS-PAGE). This CD3E protein ran along the gel to the band of approximately 53 kDa molecular weight.

CD3E is a gene providing instruction of making a protein named T-cell surface glycoprotein CD3 epsilon chain (also abbreviated as CD3e) in human. CD3e is a single-pass type I membrane glycoprotein on the surface of T cells. The CD3e molecule forms a T-cell receptor-CD3 complex with CD3-γ, CD3-δ and CD3-ζ as well as T cell receptor α/β and γ/δ heterodimers. This complex plays an important role in coupling antigen recognition to multiple intracellular signal transduction pathways. The CD3e molecule plays a critical role in the development of T cells, and a defect in the CD3E gene can cause severe immunodeficiency.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Preservative information
* The type and state (liquid/lyophilized) of the preservatives and surfactant used.
- If it is lyophilized, provide the concentration after the lyophilization.
- If it does not contain any preservative, let me know as well.

The protein doesn't contain any preservatives or surfactant.Our default shipping format is lyophlized. The buffer information is Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Target Background

Function

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.

Gene References into Functions

The ionic CD3-epsilon -Lck interaction controls the phosphorylation level of the T-cell receptor. PMID: 28659468
A novel pathogenic frameshift variant of CD3E gene has been found in two unrelated T-B+ NK+ severe combined immunodeficiency infants from Turkey. PMID: 28597365
the stalk domains of NKp30 and NKp46, another NCR employing CD3zeta for signaling, were not exchangeable without drastic deficiencies in folding, plasma membrane targeting, and/or ligand-induced receptor signaling. PMID: 27754869
The inducible recruitment of WASp to the TCR-CD3 complex is partially dependent of tyrosine phosphorylation of Cd3e. PMID: 26342115
increase. Our results indicate that the change in CD3zeta-chain expression from the baseline is an independent predictor of residual and recurrent head and neck squamous cell carcinoma. PMID: 26888626
Data suggest that HIV-1 gp41 transmembrane domain (TMD) directly interacts with TMDs of the T-cell receptor and it's CD3-antigen co-receptors (delta, gamma, and epsilon); these interactions appear to be involved in immune evasion mechanism of HIV-1. PMID: 26828096
that Nck recruitment to the TCR is fundamental to mount an efficient T cell response in vivo, and that the Nck-CD3epsilon interaction may represent a target for pharmacological modulation of the immune response. PMID: 24470497
ABCB1 homozygous 3435 TT carrier subjects showed the lowest Pgp activity compared with 3435 CT and CC carriers of renal transplant patients. PMID: 23216707
Local changes in the lipid composition of TCR microclusters render the CD3epsilon cytoplasmic domain accessible during early stages of T cell activation. PMID: 23166358
Results show that levels of CD3epsilon, CD25, CD68, and ICAM-1 mRNA in BCC biopsies may predict risk for new basal cell carcinomas. PMID: 21980389
analysis of the transgenic integration site in immunodeficient tgepsilon26 human CD3epsilon transgenic mice PMID: 21203507
Results suggest that generation of CD3varepsilon chain isoforms with different N-terminal sequence and pI is a general phenomenon. PMID: 19616027
Recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. PMID: 12110186
T cell receptor can be recruited to a subset of plasma membrane rafts, independently of cell signaling and attendantly to raft clustering PMID: 12499387
SCID is caused by a CD3E deficiency. PMID: 15546002
CD3 expression was strong in normal proximal and distal tubular epithelium and in renal oncocytomas, weak in chromophobe carcinoma, and negative in clear cell carcinomas, in papillary renal cell carcinoma, and in a transitional cell carcinoma. PMID: 16308105
The CD3 epsilon immune recognition receptor cytoplasmic domain binds to acidic and mixed phospholipid vesicles with a binding strength that correlates with the protein net charge and the presence of clustered basic amino acid residues. PMID: 17176095
CD3epsilon-mediated signal transduction pathway is essential for this transformation process PMID: 17507663
Notch-dependent cytoplasmic CD3 expression can only be achieved during the early phase of NK-cell differentiation. PMID: 17630354
In lung adenocarcinoma patients, significant decreases of MFI values for CD3epsilon, but not CD3zeta, were found in CD4+T and CD8+T cells from pleural effusion compared to peripheral blood and in peripheral blood of patients compared to healthy donors. PMID: 17668204
Data show that Nck forms a complex with an atypical PxxDY motif of the CD3epsilon tail, which encompasses Tyr166 within the activation motif and a T-cell receptor endocytosis signal. PMID: 18555270
Data show that anti-CD3 monoclonal antibody (MAb)-mediated chimpanzee T-cell activation is a function of the anti-CD3 MAb isotype and is not governed by Siglec expression. PMID: 18667496
Results revealed that the human CD3 epsilon subunit forms a homodimer structure, which provide insight into our understanding of the molecular assembly of the CD3 molecular complex. PMID: 19724882

Hide All

Involvement in disease

Immunodeficiency 18 (IMD18)

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Database Links

HGNC: 1674

OMIM: 186830

KEGG: hsa:916

STRING: 9606.ENSP00000354566

UniGene: Hs.3003

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address