Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CD3 epsilon; CD3e; CD3e antigen; CD3e antigen epsilon polypeptide (TiT3 complex); CD3E antigen epsilon polypeptide; CD3E antigen, epsilon subunit; CD3e molecule epsilon; CD3e molecule, epsilon (CD3 TCR complex); CD3e molecule, epsilon (CD3-TCR complex); CD3E_HUMAN; IMD18; T cell antigen receptor complex epsilon subunit of T3; T cell surface antigen T3/Leu 4 epsilon chain; T cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 epsilon chain; T3E; TCRE
Species
Homo sapiens (Human)
Expression Region
23-207aa
Target Protein Sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The process of expressing the recombinant human CD3E protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 23-207aa of the human CD3E protein and N-terminal GST tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal GST-tagged recombinant CD3E protein was obtained. This recombinant CD3E protein is characterized by high purity (>90%, SDS-PAGE). This CD3E protein ran along the gel to the band of approximately 53 kDa molecular weight.
CD3E is a gene providing instruction of making a protein named T-cell surface glycoprotein CD3 epsilon chain (also abbreviated as CD3e) in human. CD3e is a single-pass type I membrane glycoprotein on the surface of T cells. The CD3e molecule forms a T-cell receptor-CD3 complex with CD3-γ, CD3-δ and CD3-ζ as well as T cell receptor α/β and γ/δ heterodimers. This complex plays an important role in coupling antigen recognition to multiple intracellular signal transduction pathways. The CD3e molecule plays a critical role in the development of T cells, and a defect in the CD3E gene can cause severe immunodeficiency.