Recombinant Human Telomerase protein component 1 (TEP1), partial

In Stock
Code CSB-EP859117HU1
Abbreviation Recombinant Human TEP1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TEP1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
TEP1; TLP1; TP1; Telomerase protein component 1; Telomerase-associated protein 1; Telomerase protein 1; p240; p80 telomerase homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-226aa
Target Protein Sequence
EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Telomerase protein component 1 (TEP1) is produced using an E. coli expression system and comes with a 6xHis-tag attached to the N-terminus, which makes purification more straightforward. This product contains a partial protein sequence that spans amino acids 2-226. SDS-PAGE analysis confirms the purity exceeds 90%, which appears suitable for various research applications. This protein is strictly for research use—not intended for diagnostic or therapeutic purposes.

TEP1 is part of the telomerase complex, a cellular machinery that seems crucial for maintaining telomeres—those protective caps found at chromosome ends. The protein likely contributes to telomere length regulation and stability, processes that may be vital for cellular aging and replication. Research on cellular longevity and aging-related mechanisms often focuses on this component.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies

This N-terminal fragment of TEP1 (amino acids 2-226) could help researchers investigate protein-protein interactions within the N-terminal region of this telomerase complex component. The 6xHis tag allows for purification and immobilization in pull-down assays, potentially identifying binding partners or confirming suspected interactions. Researchers might use this recombinant fragment in co-immunoprecipitation experiments and surface plasmon resonance studies to characterize how it binds with other telomerase components or regulatory proteins, including binding kinetics and affinities.

2. Antibody Development and Validation

The recombinant TEP1 fragment works as an antigen for creating specific antibodies targeting the N-terminal region of human TEP1. Its high purity (>90%) and well-defined amino acid sequence (2-226) make it potentially suitable for immunization protocols and antibody screening that follows. Scientists can then validate these antibodies using this recombinant protein in ELISA, Western blot, and other immunoassays to check specificity and determine cross-reactivity profiles.

3. Structural and Biochemical Characterization

This partial TEP1 protein may prove useful in structural biology studies aimed at understanding how the N-terminal region folds and organizes its domains. Biophysical techniques like circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation could provide insights into the protein's secondary structure, oligomerization state, and stability. The defined fragment boundaries (2-226aa) allow researchers to focus their analysis on this specific region's biochemical properties.

4. His-Tag Affinity-Based Assays

The N-terminal 6xHis tag opens up possibilities for developing various affinity-based research assays, including nickel-column chromatography for protein complex purification and His-tag specific ELISA formats. Scientists can immobilize the tagged protein on nickel-coated surfaces to screen for potential small molecule ligands or create binding assays with other cellular components. This approach may help control the orientation and presentation of the TEP1 fragment in experimental setups.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC.
Gene References into Functions
  1. The current results suggested that genetic variants at TEP1 SNPs rs1760893 and rs1713423 may be associated significantly with increased risk of stomach cancer. PMID: 27305982
  2. TEP1 Polymorphisms are not associated with Hepatocellular Carcinoma in Thai Patients with Chronic Hepatitis B Virus Infection. PMID: 27221889
  3. These data suggest that genetic variations in the TEP1 gene may be biomarkers for risk of PCa and BCR after RP. PMID: 26238235
  4. 8 common SNPs in telomerase reverse transcriptase (TERT) and telomerase-associated protein 1 (TEP1) were genotyped. PMID: 24269974
  5. the protein levels of MVP, TEP1 and vPARP are actually increased in the highergrade tumors suggesting existence of post-transcriptional regulation of vault component production. PMID: 23739867
  6. TP1 expression did not change after cisplatin exposure for 72 hours. PMID: 11942411
  7. TEP1, hTR, hsp90, p23, and dyskerin remained at high and unchanged levels throughout up- or down regulation of telomerase activity. PMID: 12135483
  8. expression of telomerase activity and its subunit level in pancreatic carcinoma significantly correlate with the clinical stage of pancreatic carcinoma PMID: 12918126
  9. Telomerase activity and hTERT, TP-1 mRNA expression are up-regulated in esophageal squamous cell carcinoma PMID: 14606063
  10. The epithelial expression of TP-1 is elevated in mildly active UC. PMID: 18938767
  11. TEP1, TOPOIIalpha, and HSP90 interact directly with BLM in vitro and modulate its helicase activity on telomere-like DNA substrates but not on non-telomeric substrates. PMID: 19329795

Show More

Hide All

Subcellular Location
Nucleus. Chromosome, telomere.
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 11726

OMIM: 601686

KEGG: hsa:7011

STRING: 9606.ENSP00000262715

UniGene: Hs.508835

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*