Recombinant Human Telomerase protein component 1 (TEP1), partial

In Stock
Code CSB-EP859117HU1
Abbreviation Recombinant Human TEP1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
TEP1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
TEP1; TLP1; TP1; Telomerase protein component 1; Telomerase-associated protein 1; Telomerase protein 1; p240; p80 telomerase homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-226aa
Target Protein Sequence
EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Telomerase protein component 1 (TEP1) is produced using an E. coli expression system and comes with a 6xHis-tag attached to the N-terminus, which makes purification more straightforward. This product contains a partial protein sequence that spans amino acids 2-226. SDS-PAGE analysis confirms the purity exceeds 90%, which appears suitable for various research applications. This protein is strictly for research use—not intended for diagnostic or therapeutic purposes.

TEP1 is part of the telomerase complex, a cellular machinery that seems crucial for maintaining telomeres—those protective caps found at chromosome ends. The protein likely contributes to telomere length regulation and stability, processes that may be vital for cellular aging and replication. Research on cellular longevity and aging-related mechanisms often focuses on this component.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant human TEP1 is produced in an E. coli expression system as a partial fragment (2-226aa) with an N-terminal 6xHis-tag. TEP1 is a complex eukaryotic protein that requires precise folding and proper integration into the telomerase complex for its biological function in telomere maintenance. E. coli expression systems cannot provide the necessary eukaryotic folding environment and may lack the chaperones required for correct folding of this multidomain protein. The partial nature of the fragment (approximately 25% of full-length TEP1) may not fold independently as it would in the context of the full-length protein. Purity >90% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., complex formation assays, circular dichroism) are provided. Therefore, the protein's folding status and bioactivity cannot be confirmed and are likely compromised.

1. Protein-Protein Interaction Studies

If correctly folded (unverified), this TEP1 fragment could be used to study interactions with other telomerase components, as the His-tag facilitates immobilization for pull-down assays. However, if misfolded (probable in E. coli), interaction domains may be altered, leading to non-specific binding or failure to recognize genuine biological partners, compromising the validity of identified interactions within the telomerase complex.

2. Antibody Development and Validation

This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The defined fragment (2-226aa) provides specific epitopes for antibody production. However, antibodies generated against a potentially misfolded protein may not optimally recognize conformation-dependent epitopes of native TEP1 in biological contexts.

3. Structural and Biochemical Characterization

If properly folded, the fragment could be used for limited structural studies of the N-terminal region. However, if misfolded, biophysical data would misrepresent the native protein's properties. The partial nature of the fragment limits insights into the full-length TEP1 structure and domain organization.

4. His-Tag Affinity-Based Assays

The His-tag enables technical feasibility for immobilization-based assays regardless of folding status. However, if misfolded, screening results may not reflect biological relevance, as the protein's binding sites may be altered or inaccessible in their native conformation.

Final Recommendation & Action Plan

This E. coli-expressed partial TEP1 fragment requires validation before functional applications due to the high probability of misfolding. Recommended actions: (1) Validate folding through biophysical methods (circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state); (2) Test functionality through interaction assays with known TEP1 binding partners if available; (3) For reliable results, consider eukaryotic expression systems that support proper folding or use full-length constructs; (4) Antibody development can proceed but requires validation against native protein; (5) Avoid functional studies until proper folding is confirmed. Always include appropriate controls and consider the limitations of studying isolated domains rather than full-length protein complexes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC.
Gene References into Functions
  1. The current results suggested that genetic variants at TEP1 SNPs rs1760893 and rs1713423 may be associated significantly with increased risk of stomach cancer. PMID: 27305982
  2. TEP1 Polymorphisms are not associated with Hepatocellular Carcinoma in Thai Patients with Chronic Hepatitis B Virus Infection. PMID: 27221889
  3. These data suggest that genetic variations in the TEP1 gene may be biomarkers for risk of PCa and BCR after RP. PMID: 26238235
  4. 8 common SNPs in telomerase reverse transcriptase (TERT) and telomerase-associated protein 1 (TEP1) were genotyped. PMID: 24269974
  5. the protein levels of MVP, TEP1 and vPARP are actually increased in the highergrade tumors suggesting existence of post-transcriptional regulation of vault component production. PMID: 23739867
  6. TP1 expression did not change after cisplatin exposure for 72 hours. PMID: 11942411
  7. TEP1, hTR, hsp90, p23, and dyskerin remained at high and unchanged levels throughout up- or down regulation of telomerase activity. PMID: 12135483
  8. expression of telomerase activity and its subunit level in pancreatic carcinoma significantly correlate with the clinical stage of pancreatic carcinoma PMID: 12918126
  9. Telomerase activity and hTERT, TP-1 mRNA expression are up-regulated in esophageal squamous cell carcinoma PMID: 14606063
  10. The epithelial expression of TP-1 is elevated in mildly active UC. PMID: 18938767
  11. TEP1, TOPOIIalpha, and HSP90 interact directly with BLM in vitro and modulate its helicase activity on telomere-like DNA substrates but not on non-telomeric substrates. PMID: 19329795

Show More

Hide All

Subcellular Location
Nucleus. Chromosome, telomere.
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 11726

OMIM: 601686

KEGG: hsa:7011

STRING: 9606.ENSP00000262715

UniGene: Hs.508835

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*