Recombinant Human Transient receptor potential cation channel subfamily V member 1 (TRPV1), partial

Code CSB-EP822774HU
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TRPV1
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-155aa
Target Protein Sequence
MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
48.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand-activated non-selective calcium permeant cation channel involved in detection of noxious chemical and thermal stimuli. Seems to mediate proton influx and may be involved in intracellular acidosis in nociceptive neurons. Involved in mediation of inflammatory pain and hyperalgesia. Sensitized by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases, which involves PKC isozymes and PCL. Activation by vanilloids, like capsaicin, and temperatures higher than 42 degrees Celsius, exhibits a time- and Ca(2+)-dependent outward rectification, followed by a long-lasting refractory state. Mild extracellular acidic pH (6.5) potentiates channel activation by noxious heat and vanilloids, whereas acidic conditions (pH <6) directly activate the channel. Can be activated by endogenous compounds, including 12-hydroperoxytetraenoic acid and bradykinin. Acts as ionotropic endocannabinoid receptor with central neuromodulatory effects. Triggers a form of long-term depression (TRPV1-LTD) mediated by the endocannabinoid anandamine in the hippocampus and nucleus accumbens by affecting AMPA receptors endocytosis.
Gene References into Functions
  1. Correlation between heat pain threshold and TRPV1 receptor protein level over various phases of the ovarian-menstrual cycle has been reported. PMID: 29578437
  2. C-fibers and transient receptor potential cation channel, subfamily V, member 1 protein (TRPV 1)-mediated vasodilations are impaired in type 1 diabetes (T1D) patients. PMID: 28287157
  3. Src kinase mediates UV-induced TRPV1 trafficking into cell membrane in HaCaT keratinocytes. PMID: 29080357
  4. Disruption of the association of Sig-1R with TRPV1 by synthetic or natural antagonists leads to degradation of TRPV1 protein and to decreased levels of the ion channel protein as well as to a decrease in TRPV1-associated pain. PMID: 29378958
  5. A strong capacity to positively regulate skin sensitization mechanisms related to the TRPV1 receptors. PMID: 29562624
  6. Activation of TRPV1 channels attenuates ischemia-reperfusion-induced injury in a variety of organs including heart, kidney, lungs, and brain possibly via enhancing the discharge of calcitonin gene-related peptide and substance P PMID: 28466657
  7. cystinosis patients homozygous for the 57-kb deletion exhibit a strong reduction of TRPV1 function, leading to sensory deficiencies akin to the phenotype of TRPV1-deficient mice PMID: 27734949
  8. The TRPV1 mRNA were significantly upregulated in chronic Low Back Pain compared with controls. PMID: 28481838
  9. antitumor and apoptosis effects of 5-FU are up-regulated by activation of TRPV1 channels, but its action was down-regulated by HPer treatment. It seems that HPer cannot be used for increasing the antitumor effect of 5-FU through modulation of the TRPV1. PMID: 28795251
  10. TRPV1 interacts physically with MOR-1 and modulates MOR-1 activity in HEK293 cells. PMID: 29203659
  11. the expression of transient receptor potential vanilloid-1 (TRPV1), transient receptor potential vanilloid-2 (TRPV2) and transient receptor potential vanilloid-3 (TRPV3) channels in native human odontoblasts, was examined. PMID: 28905239
  12. activation of TRPV1, but not TRPA1 mediates a calcium-dependent cell death. PMID: 29129206
  13. Apoptosis and oxidant effects of cisplatin were increased by activation of TRPV1 channels, but its action on the values was further increased by the ALA treatment. Combination therapy of Alpha-lipoic acid and cisplatin could be used as an effective strategy in the treatment of breast cancer. PMID: 28849985
  14. Analysis of structural, dynamic, and hydrophobic organization of the pore domain revealed entropy growth upon TRPV1 gating, which is in line with current concepts of thermal sensitivity. PMID: 27612191
  15. TRPV5 and TRPV6 lack a positively charged residue in the TM4-TM5 loop that was shown to interact with PI(4,5)P2 in TRPV1, which shows high affinity for this lipid PMID: 27291418
  16. SMFAs ubiquitously express functional TRPV1 channels. PMID: 28681979
  17. Both TRPV1 and GRP are implied in midbrain physiology of importance to neurological and neuropsychiatric disorders. PMID: 27762319
  18. positive correlation between VR1 and PGE2 expression in leiomyoma cells and areas with pain around the tumors PMID: 28026039
  19. 5'UTR influences the stability and translation efficacy of TRPV1 transcripts, and that TRPV1 variant three (TRPV1v3) was the most stable and the only variant expressed in glioblastoma samples and in glioma stem-like cells. PMID: 27829230
  20. Upper gastrointestinal symptoms are more common in subjects with a higher consumption of spicy foods, younger age and female gender, regardless of TRPV1 genotypes and the H. pylori infection status. PMID: 27094759
  21. Mean TRPV-1 and TRPA-1 gene expression was higher in IPF patients compared with controls, but the difference did not reach statistical significance. Immunostaining supported these findings PMID: 29149168
  22. TRPV1 and TRPA1 also act as nociceptive sensors and potentiate the inflammatory process. PMID: 28364279
  23. studies identified TRPV4 as a channel that contributes to both histamine- and chloroquine-induced itch and indicated that the function of TRPV4 in itch signaling involves TRPV1-mediated facilitation. PMID: 27436359
  24. People with the minor alleles of the TRPV1 single nucleotide polymorphisms rs161364 and rs8065080 have a lower risk of diabetes with a high-fat diet, but people with the major alleles are at a higher risk of type 2 diabetes when consuming high-fat diets. PMID: 27287034
  25. The TRPV1 transcript was present in prostate cancer-affected foci, both in the tumor tissue as well as in the adjacent untransformed part of the gland. All breast carcinoma cell lines showed robust expression of TRPV1. Trigeminal ganglion expressed significantly higher levels of TRPV1 protein than either breast or prostate cancer cells. Ectopic expression of TRPV1 decreases cancer cell survival by induction of apoptosis. PMID: 27180305
  26. This activity is independent of the NGF pathway and is not mediated by known TRPV1 toxins' binding sites. PMID: 28063984
  27. It has been shown that the propagation of the TRPV1-induced cytosolic calcium and sodium fluxes into mitochondria is dependent on coordinated activity of NCLX and MCU. PMID: 27627464
  28. Endogenous TRPV1 stimulation leads to the activation of the inositol phospholipid pathway necessary for sustained Ca(2+) oscillations. PMID: 27663071
  29. The distinct localization of TRPV1 receptor, supports the concept of a role in the functional activity of the trigeminal sensory system. PMID: 27456865
  30. This study showed that oleoylethanolamine and palmitoylethanolamine have endogenous roles and potential therapeutic applications in conditions of intestinal hyperpermeability and inflammation. PMID: 27623929
  31. The slow sustained current mediated by TRPV1. PMID: 28522561
  32. This study suggests that the TRPV1 channel is involved in interferon beta-induced flu-like syndrome in patients with relapsing-remitting multiple sclerosis. PMID: 28284340
  33. Respiratory syncytial virus and measles virus infection upregulates TRPV1 expression in bronchial epithelial cells. PMID: 28187208
  34. These studies suggest that TRPV1 is expressed on airway smooth muscle. PMID: 28336810
  35. mutational analysis of human TRPV1 was performed, and four agonists (capsaicin, RTX, [6]-shogaol and [6]-gingerol) were used to identify amino acid residues involved in ligand binding and/or modulation of proton sensitivity. PMID: 27606946
  36. Therefore, and considering the desensitization of TRPV1s in diabetic pancreata, a TRPV1-to-secretagogin regulatory axis seems critical to maintain the structural integrity and signal competence of beta-cells. PMID: 28637794
  37. Acute administration of 5-hydroxytryptamine4 (5-HT4) receptor agonist, mosapride or esophageal infusion of the transient receptor potential vanilloid receptor-1 (TRPV1) agonist capsaicin promotes secondary peristalsis.Esophageal infusion with capsaicin-containing red pepper sauce suspension does create greater mechanosensitivity as measured by secondary peristalsis than 5-HT4 receptor agonist mosapride PMID: 27438088
  38. Results demonstrated a role of TRPV1 as mediator of sperm thermotaxis in humans. PMID: 27992447
  39. There is increased expression of TRPV1 in the rectosigmoid mucosa of diarrhea-predominant irritable bowel syndrome patients. PMID: 27250983
  40. TRPV1 expression is upregulated in subjects with sensitive skin, and it correlates with the intensity of the symptoms. Our findings suggest a role for this receptor in the pathogenesis of sensitive skin syndrome. PMID: 26695734
  41. Mitogenic responses to EGF and VEGF are mediated through TRPV1 transactivation. Only in hPtEC do the increases in proliferation induced by EGF exceed those in HCjEC. Therefore, TRPV1 is a potential drug target whose clinical relevance in treating pterygium warrants further assessment. PMID: 27163769
  42. capsaicin stabilizes the open state of TRPV1 by "pull-and-contact" with the S4-S5 linker. PMID: 28044278
  43. REVIEW: role in pain and pain treatment PMID: 27240888
  44. By comparing the closed-state molecular dynamics simulations of TRPV1 at 30 degrees C and 60 degrees C, there were observed heat-activated conformational changes in the MPD linker, the outer pore, and the TRP helix that resemble the closed-to-open conformational changes of the protein, along with partial formation of the open-state specific hydrogen bonds. PMID: 27699868
  45. These findings suggest that specific molecular interactions control TRPV1 activation by particles, differential activation, and desensitization of TRPV1 by particles and/or other agonists, and cellular changes in the expression of TRPA1 as a result of I585V expression could contribute to variations in asthma symptom control. PMID: 27758864
  46. Acidic stimulation increased IL-8 production in LECs, whereas a selective transient receptor potential vanilloid subtype 1 (TRPV1) antagonist, 5'-iodoresiniferatoxin, decreased IL-8 production. PMID: 27312995
  47. Activation of TRPV1 with capsaicin attenuates neointimal formation by accelerating re-endothelialization through upregulation of Mfn2. PMID: 26947234
  48. Our results have demonstrated that capsaicin and resiniferatoxin form nanomolar complexes with calmodulin, and competitively inhibit TRPV1-calmodulin interaction. These interactions involve the protein recognition interface of calmodulin, which is responsible for all of the cell-regulatory calmodulin-protein interactions. PMID: 27339229
  49. In this review, we first describe the chemical and pharmacological properties of capsaicin and its derivatives in relation to their analgesic properties. We then consider the biochemical and functional characteristics of TRPV1, focusing on its distribution and biological effects within the somatosensory and viscerosensory nociceptive systems. PMID: 27322240
  50. TRPV1 overexpression attenuates isoproterenolinduced myocardial fibrosis. PMID: 27314441

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell projection, dendritic spine membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV1 sub-subfamily
Tissue Specificity
Widely expressed at low levels. Expression is elevated in dorsal root ganglia. In skin, expressed in cutaneous sensory nerve fibers, mast cells, epidermal keratinocytes, dermal blood vessels, the inner root sheet and the infundibulum of hair follicles, di
Database Links

HGNC: 12716

OMIM: 602076

KEGG: hsa:7442

STRING: 9606.ENSP00000459962

UniGene: Hs.579217

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*