Recombinant Human Tropomyosin alpha-4 chain(TPM4)

Code CSB-EP024108HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P67936
Relevance Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. Binds calcium.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias TM30p1 Tropomyosin-4
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
Research Area Signal Transduction
Source E.coli
Gene Names TPM4
Protein Names Recommended name: Tropomyosin alpha-4 chain Alternative name(s): TM30p1 Tropomyosin-4
Expression Region 1-248aa
Tag Info N-terminal GST-tagged
Mol. Weight 55.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments (By similarity). Binds calcium
Subcellular Location Cytoplasm, cytoskeleton
Protein Families Tropomyosin family
Tissue Specificity Detected in cardiac tissue and platelets, the form found in cardiac tissue is a higher molecular weight than the form found in platelets. Expressed at higher levels in the platelets of hypertensive patients with cardiac hypertrophy than in the platelets o
Database Links

HGNC: 12013

OMIM: 600317

KEGG: hsa:7171

UniGene: Hs.631618

Pathway Cardiac muscle contraction

Related Products

TPM4 Antibodies

TPM4 Antibodies for Homo sapiens (Human)

TPM4 Antibodies for Human

TPM4 Proteins

TPM4 Proteins for Homo sapiens (Human)

TPM4 ELISA Kit

TPM4 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.