Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2)

In Stock
Code CSB-EP025484HU
Abbreviation Recombinant Human UBE2V2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
UBE2V2
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
1 alpha 25 dihydroxyvitamin D3 inducible; DDVit 1; DDVIT1; EDAF-1; EDAF1; EDPF-1; EDPF1; Enterocyte differentiation associated factor EDAF 1; Enterocyte differentiation promoting factor; Enterocyte differentiation-associated factor 1; Enterocyte differentiation-promoting factor 1; Methyl methanesulfonate sensitive 2; MMS 2; MMS2; MMS2 homolog; UB2V2_HUMAN; UBE2V 2; UBE2V2; Ubiquitin conjugating enzyme E2 variant 2; Ubiquitin conjugating enzyme E2v2; Ubiquitin-conjugating enzyme E2 variant 2; UEV 2; UEV2; Vitamin D3 inducible protein; Vitamin D3-inducible protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-145aa
Target Protein Sequence
AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human UBE2V2 was expressed with the amino acid range of 2-145. This UBE2V2 protein is theoretically predicted to have a molecular weight of 32.2 kDa. This UBE2V2 protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of UBE2V2, which enables a simple process of detecting and purifying the UBE2V2 recombinant protein in the following steps.

The human ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2), a member of the ubiquitin-conjugating enzyme (E2) family, is involved in the ubiquitin-proteasome system, a cellular mechanism responsible for the targeted degradation of proteins. UBE2V2 plays a crucial role in the formation of polyubiquitin chains, which serve as signals for protein degradation. Specifically, UBE2V2 functions as a ubiquitin-conjugating enzyme variant, working in conjunction with UBE2V1 to catalyze the synthesis of polyubiquitin chains. These chains are then attached to target proteins, marking them for degradation by the proteasome. The ubiquitin-proteasome system is vital for maintaining cellular homeostasis and regulating various processes such as cell cycle progression, signal transduction, and response to cellular stress. Research areas involving UBE2V2 often focus on understanding the molecular mechanisms of protein degradation and its implications in cellular functions and diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Gene References into Functions
  1. Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication. PMID: 25910425
  2. suppression of hMMS2 reverses L-OHP tolerance in differentiated human colorectal carcinoma cells by promoting apoptosis PMID: 24846979
  3. UBE2v2 signalling through PCNA ubiquitination is not required for immunoglobulin diversification in DT40 cells. PMID: 15725630
  4. Insight into the influence of protein dynamics on the affinity of ubiquitin for Mms2. PMID: 15952783
  5. Mms2 physical association with ubiquitin is correlated with its ability to promote Lys63-linked ubiquitin chain assembly PMID: 17964296
  6. These results point to a high level of redundancy in the DNA damage tolerance pathway and suggest the existence of another hMMS2 variant (hMMSv) or complex that can compensate for its loss. PMID: 18284681

Show More

Hide All

Protein Families
Ubiquitin-conjugating enzyme family
Tissue Specificity
Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
Database Links

HGNC: 12495

OMIM: 603001

KEGG: hsa:7336

STRING: 9606.ENSP00000428209

UniGene: Hs.491695

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*