Recombinant Human Ubiquitin-like-conjugating enzyme ATG3 (ATG3)

Code CSB-EP002288HU
Abbreviation Recombinant Human ATG3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Apoptosis
Alternative Names
2610016C12Rik; Apg 3; APG3; APG3 autophagy 3 like; APG3 like; APG3, S. cerevisiae, homolog of; APG3-like; APG3L; Apg3p; ATG 3; ATG3; ATG3 autophagy related 3 homolog; ATG3 autophagy related 3 homolog (S. cerevisiae); ATG3_HUMAN; Autophagy 3, S. cerevisiae, homolog of; Autophagy Apg3p/Aut1p like; autophagy related 3; Autophagy related protein 3; Autophagy-related protein 3; DKFZp564M1178; FLJ22125; hApg3; MGC15201; OTTHUMP00000214547; OTTHUMP00000214548; PC3 96; Protein PC3-96; Ubiquitin-like-conjugating enzyme ATG3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-314aa
Target Protein Sequence
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8-like proteins from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8-like proteins. The formation of the ATG8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway.
Gene References into Functions
  1. ATG3 was targeted by miR-23a, suggesting that ATG3 is an autophagy-related competing endogenous RNA. PMID: 30007957
  2. Results revealed that miR-16 was significantly downregulated, and ATG3 was significantly upregulated in non-small cell lung carcinoma (NSCLC) patient tissue samples. ATG3 was found to be a direct target of miR-16. PMID: 29138833
  3. miR-155 silencing rescued autophagosome number in Mycobacterium tuberculosis infected dendritic cells and enhanced autolysosome fusion, thereby supporting a previously unidentified role of the miR-155 as inhibitor of ATG3 expression. PMID: 29300789
  4. PTK2 inhibition-induced sustained levels of ATG3 were able to sensitize cancer cells to DNA-damaging agents. PMID: 28103122
  5. Our data demonstrate that HOTAIR promotes the activation of autophagy in HCC cells by upregulating the expression of the autophagy-related genes ATG3 and ATG7. PMID: 27301338
  6. ATG3 upregulation contributes to autophagy induced by the detachment of intestinal epithelial cells from the extracellular matrix, but promotes autophagy-independent apoptosis of the attached cells PMID: 26061804
  7. Hidden Markov models were used to detect protein homology among the flexible regions of Atg3 homologs and importance of conserved regions evaluated by performing affinity capture experiments with human Atg3 deletion constructs; binding studies and competition experiments demonstrate that overlapping sites in the Atg3FR are important for E3 binding and E1 binding. PMID: 24186333
  8. The region of human ATG3 that interacts with ATG7 is precisely identified using nuclear magnetic resonance. PMID: 26043688
  9. ATG3 gene and its gene family may play an important role in transformation of myelodysplastic syndrome. PMID: 24420857
  10. Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3. PMID: 24747438
  11. 13 residues of the ATG3 fragment form a short beta-strand followed by an alpha-helix on a surface area that is an exclusive binding site for ATG12. PMID: 24191030
  12. caspase-8 overexpression led to Atg3 degradation and this event depended on caspase-8 enzymatic activity PMID: 22644571
  13. These results unveil a role for ATG12-ATG3 in mitochondrial homeostasis and implicate the ATG12 conjugation system in cellular functions distinct from the early steps of autophagosome formation. PMID: 20723759
  14. Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p PMID: 11825910
  15. Murine Atg8L/Apg8L modification is mediated by human Atg3. PMID: 16704426

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
ATG3 family
Tissue Specificity
Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta.
Database Links

HGNC: 20962

OMIM: 609606

KEGG: hsa:64422

STRING: 9606.ENSP00000283290

UniGene: Hs.477126

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*