Recombinant Human Vacuolar protein sorting-associated protein 4A (VPS4A)

In Stock
Code CSB-EP891974HU
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
VPS4A
Uniprot No.
Research Area
Others
Alternative Names
(Protein SKD2)(VPS4-1)(hVPS4)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-437aa
Target Protein Sequence
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
53.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Involved in cytokinesis: retained at the midbody by ZFYVE19/ANCHR and CHMP4C until abscission checkpoint signaling is terminated at late cytokinesis. It is then released following dephosphorylation of CHMP4C, leading to abscission. VPS4A/B are required for the exosomal release of SDCBP, CD63 and syndecan.; (Microbial infection) In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses).
Gene References into Functions
  1. These results demonstrate that the ESCRT machinery, and in particular VPS4, plays a critical role in the early stages of PV infection. PMID: 28349933
  2. Continuous ESCRT-III remodelling by dynamic subunit turnover is regulated by Vps4 to mediate membrane remodelling during cytokinesis. PMID: 28604678
  3. associations were noted between the striatal node, hyperactivity, and the vacuolar protein sorting-associated protein 4A (VPS4A) gene in humans, and the causal role of Vps4 for hyperactivity was validated in Drosophila PMID: 27001827
  4. These results point to the existence of previously undetected biological functions of the FTase alpha subunit that includes control of intracellular membrane trafficking. PMID: 26551458
  5. these experiments suggest that miR-16 and VPS4a expression are altered in end-stage heart failure and in response to unloading with a left ventricular assist device PMID: 25033200
  6. Ca2+-dependent accumulation of ESCRT III-Vps4 complex following large focal injury to the cell membrane and identify the role of ALG-2 as the initiator of sequential ESCRT III-Vps4A/B complex assembly. PMID: 25534348
  7. Vps4A may function as a tumor suppressor, which utilizes exosomes as mediators to regulate the secretion and uptake of miRNAs in hepatoma cells; these observations provide new insights into the development of HCC. PMID: 25503676
  8. Vps4 stimulatory element of the cofactor Vta1 contacts the ATPase Vps4 alpha7 and alpha9 subunits to stimulate ATP hydrolysis. PMID: 25164817
  9. Propose that the abscission checkpoint is mediated by ANCHR and CHMP4C through retention of VPS4 at the midbody ring. PMID: 24814515
  10. VPS4 is required for endosomal transport of LDL cholesterol in HeLa cells. PMID: 23009658
  11. silencing CHMP6 and VPS4A also blocked epidermal growth factor receptor (EGFR) recycling PMID: 22231449
  12. VPS4, a master regulator of MVB sorting, may serve as a determinant of lysosomal targeting or extracellular secretion of alphaSYN and thereby contribute to the intercellular propagation of Lewy pathology in PD PMID: 22216284
  13. These results indicate that VPS4A has a direct role in membrane scission leading to HIV-1 release. PMID: 21394086
  14. Findings reveal new ways in which VPS4 activity is regulated and specifically directed to ESCRT-III polymers. PMID: 20805225
  15. It was found that neither siRNA knockdown of VPS4A and VPS4B expression nor the use of cell lines that inducibly express VPS4A or VPS4B dominant negative mutants, inhibited influenza virus budding. PMID: 20621136
  16. ESCRT-III/VPS4 proteins function at centrosomes to help regulate their maintenance or proliferation and then at midbodies during abscission, thereby helping ensure the ordered progression through the different stages of cell division. PMID: 20616062
  17. Vps4 and the ESCRT-III complex are required for the release of infectious hepatitis C virus particles. PMID: 19828764
  18. SKD1-dependent endosomal membrane trafficking is required for formation of autolysosomes. PMID: 11937716
  19. Data suggested that hVPS4 is involved in the release of components of the bilayered coat from the endosomal membrane. PMID: 15075231
  20. hSnf7-1 binds to itself, membranes, and the AAA+ ATPase SKD1 PMID: 15632132
  21. The solution structure of the N-terminal VPS4A microtubule interacting and transport (MIT) domain was reported. PMID: 16174732
  22. in cells expressing dominant negative VPS4a, doxorubicin accumulates in VPS4a-positive vesicles and drug sequestration is inhibited PMID: 16841193
  23. Upon coexpression of mutated CHMP3, CHMP4B, or CHMP4C forms, as well as of ATPase-defective Vps4A or Vps4B mutants, HBV assembly and egress were potently blocked. PMID: 17553870
  24. Inhibits Vesicular Stomatitis Virus budding but does not affect Semliki Forest Virus budding. PMID: 17913808
  25. studies reveal how the VPS4 ATPases recognize their CHMP substrates to facilitate the membrane fission events required for the release of viruses, endosomal vesicles and daughter cells PMID: 17928862
  26. Respiratory syncytial virus uses a Vps4-independent budding mechanism controlled by Rab11-FIP2. PMID: 18621683
  27. Overall, we see no role for the ESCRT pathway in influenza virus budding and the significance of the M1-VPS28 interaction remains to be determined. PMID: 19524996
  28. Both Vps4A and CHMP1A localized in the vicinity of viral cytoplasmic assembly compartments, sites of viral maturation that develop in Cytomegalovirus-infected cells. Thus, ESCRT machinery is involved in the final steps of HCMV replication. PMID: 19640981

Show More

Hide All

Subcellular Location
Late endosome membrane; Peripheral membrane protein. Midbody.
Protein Families
AAA ATPase family
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 13488

OMIM: 609982

KEGG: hsa:27183

STRING: 9606.ENSP00000254950

UniGene: Hs.128420

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*