Recombinant Human Versican core protein(VCAN),partial

In Stock
Code CSB-EP025810HU(A5)
Size US$2062Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names VCAN
Uniprot No. P13611
Alternative Names Chondroitin sulfate proteoglycan 2; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan core protein; cartilage; CSPG2; CSPG2_HUMAN; ERVR; GHAP; Glial hyaluronate binding protein; Glial hyaluronate-binding protein; Large fibroblast proteoglycan; PG-M; PGM; VCAN; Versican; Versican core protein; Versican proteoglycan; WGN 1; WGN; WGN1
Species Homo sapiens (Human)
Source E.coli
Expression Region 3089-3354aa
Target Protein Sequence GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 47.6 kDa
Protein Length Partial
Tag Info N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Gene References into Functions
  1. VCAN expression in colorectal cancer and its role in cetuximab resistance PMID: 28320945
  2. miR-135a-5p can suppress cell progress including cell proliferation, migration, and invasion in thyroid carcinoma by targeting VCAN 3 '-UTR. PMID: 28869452
  3. This study highlights the oncogenic role of VCAN in renal cell carcinogenesis and suggests that this gene has therapeutic and/or biomarker potential for renal cell cancer. PMID: 28242813
  4. Interleukin-17A promotes tongue squamous cell carcinoma metastasis by activating miR-23b/versican pathway in the tumor microenvironment. PMID: 28035060
  5. The macular dysfunction on mfERG was profound and of early onset. A heterozygous mutation in intron 7 of the VCAN gene (c.4004-1G > A) was found. PMID: 29071374
  6. Versican V0 and V1 isoforms were upregulated in the uterine leiomyomas of symptomatic versus asymptomatic women. Abundant cleaved versican was detected in leiomyoma and myometrium, as well as in myometrial and leiomyoma cell lines. VCAN siRNA did not effect cell proliferation, apoptosis, or smooth muscle markers, but reduced ESR1 and PR-A expression. PMID: 28323982
  7. Lumican and versican protein expression are associated with colorectal adenoma-to-carcinoma progression PMID: 28481899
  8. Removal or knockdown of versican may be a possible therapeutic strategy for increasing deposition of insoluble elastin and stimulating repair of elastic fibers in COPD lung. PMID: 28138236
  9. human myeloma tumors displaying CD8(+) infiltration/aggregates underwent VCAN proteolysis at a site predicted to generate a glycosaminoglycan-bereft N-terminal fragment. PMID: 27259980
  10. versican decreases in follicular dermal papilla as an aging-associated change of human hair follicles PMID: 27697422
  11. Data indicate that serum versican levels were significantly decreased in polycystic ovary syndrome (PCOS) patients, and that serum ADAMTS-1 (a disintegrin and metalloproteinase with thrombospondin motif-1) and versican levels were significantly and positively correlated with each other. PMID: 27908842
  12. the G1 domain of versican can regulate the organization of pericellular hyaluronan and affect phenotype of cultured human dermal fibroblasts PMID: 27126822
  13. Results highlight an important role for versican in regulating the expression and assembly of elastin and the phenotype of leiomyosarcoma cells. PMID: 26723257
  14. Versican localizes to the nucleus in proliferating mesenchymal cells and suggest role in mitotic spindle organization during cell division. PMID: 26395512
  15. VCAN and VEGF were associated with survival in CRC patients with PM after CRS and HIPEC PMID: 26873137
  16. Versican is a novel modulator of hepatic fibrosis. PMID: 26752747
  17. versican mRNA is up-regulated much more highly (>600 fold) by long term hypoxia (5 days) than by 1 day of hypoxia. PMID: 26057378
  18. Versican V1 overexpression induces a myofibroblast-like phenotype in cultured fibroblasts. PMID: 26176948
  19. Versican upregulation in Sezary cells alters growth, motility and resistance to chemotherapy. PMID: 25915825
  20. Versican isoform V1 is associated with high-grade gliomas. PMID: 25064688
  21. Significant elevation of VCAN and its associated molecules imply their role in multiple myeloma PMID: 25623955
  22. Our results suggest that TGF-beta1 up-regulates versican expression by suppressing miR-143, and this pathway is important for osteosarcoma cell migration and invasion. PMID: 25562163
  23. Circulating monocytes may contribute to the fibrotic process in a subset of systemic sclerosis patients by amplifying a positive feedback loop consisting of versican, CCL2, and the influx of monocytes PMID: 23845159
  24. Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects. PMID: 24240681
  25. Versican regulates the growth of leiomyosarcoma tumors. PMID: 25320080
  26. these data suggest that versican regulates the development of peritoneal metastasis originating from cells and spheroids. PMID: 24999371
  27. The ADAMTS5 ancillary domain and specific chondroitin sulfate chains of versican are required for proteolysis. PMID: 25122765
  28. Versican expression in tumor epithelial cells predicts a good prognosis for gastric cancer patients. PMID: 25275064
  29. Lack of versican expression is associated with recurrence in colon cancer. PMID: 22711178
  30. CD26 expression on T-anaplastic large cell lymphoma (ALCL) line Karpas 299 is associated with increased expression of versican and MT1-MMP and enhanced adhesion. PMID: 24180670
  31. FoxQ1 promotes hepatocellular carcinoma metastasis by transactivating ZEB2 and VersicanV1 expression. PMID: 24005989
  32. A novel c.4004-6T>A nucleotide substitution at the acceptor splice site of intron 7 of the VCAN gene that segregated with the Wagner disease phenotype, was identified. PMID: 24174867
  33. Cleaved versican G1 domain-containing fragments (VG1F) can be recaptured by microfibrils through VG1F homotypical interactions to enhance hyaluronan recruitment to microfibrils. PMID: 23963449
  34. altered balance of VCAN splice variants in combination with reduction in glycosaminoglycan protein modifications as pathogenic mechanisms in Wagner syndrome PMID: 22739342
  35. Letter/Case Report: disease causing versican mutation in Wagner syndrome. PMID: 23571384
  36. versican V1 enhances hCAP18/LL-37 expression in macrophages through activation of TLR2 and subsequent vitamin D-dependent mechanisms which promote ovarian tumor progression in vitro PMID: 23424670
  37. No association has been found between polymorphisms of rs251124 and rs3767137 loci of CSPG2 and HSPG2 genes and intracranial aneurysm in the selected population. PMID: 23568740
  38. Wnt/beta-catenin signal transducting system regulates dermal papilla cell aggregative growth through modifying versican expression by means of acting on the versican gene upstream promoter. PMID: 23099107
  39. these results demonstrate that versican V0 and V1 isoforms play important roles in HCC development and that versican mRNAs compete with endogenous RNAs in regulating miRNA functions. PMID: 23180826
  40. Mesenchymal cells derived from keloid lesion (KL) cells exhibit above-normal versican production. PMID: 22951719
  41. the glioblastoma cell line U87 stably transfected with versican isoform V2 formed tumors containing extensive vasculature PMID: 23201264
  42. renal versican expression was significantly upregulated as compared to corresponding controls. These data show for the first time an association of renal versican isoform V0 and V1 expression with progressive renal disease. PMID: 23024773
  43. Studies indicate that E-cadherin and versican are involved in cancer epithelial-mesenchymal transitions and metastasis. PMID: 23002209
  44. Tissue microarray analysis revealed that epithelial expression of versican had significant relations to lymph node metastasis and pathological stages of breast cancer PMID: 22318369
  45. E(2) treatment increases the amount of dermal HA and versican V2 via paracrine release of EGF, which may be implicated in the pro-proliferative and anti-inflammatory effects of E(2) during photoaging. PMID: 22493503
  46. The major isoforms expressed by gastric carcinoma & gastric cell lines were V0 & V1. V1 was higher in gastric carcinoma. Abnormally expressed versican & its isoforms participate in the progress of gastric carcinoma triggered by IL-11. PMID: 22393310
  47. RhoGDI2 suppresses lung metastasis in mouse models by reducing the expression of isoforms V1 and V3 of the proteoglycan versican, which is require for lung metastasis. High versican levels portended poor prognosis in patients with bladder cancer. PMID: 22406535
  48. Hyaluronan and versican play a role in T-cell trafficking and function in inflamed tissues. PMID: 22155153
  49. Versican is a key component of the provisional wound repair ECM that is expressed following injury to valvular interstitial cells. PMID: 21546273
  50. the G1 and G3 domains of versican were upregulated and LTBP-4 was downregulated in breast cancer stroma PMID: 21505857
  51. A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration. PMID: 22360420
  52. Versican G3 domain enhanced tumor cell resistance to apoptosis when cultured in serum free medium, Doxorubicin, or Epirubicin by up-regulating pERK and GSK-3beta (S9P). PMID: 22096483
  53. Versican demonstrated distinctive localization relative to nodules within calcified aortic valves. PMID: 21185747
  54. Data show that elevated levels of versican were correlated with higher tumor grade and invasiveness in carcinomas with MD and MAMCs, whereas increased amounts of decorin were associated with in situ carcinomas in MAMCs. PMID: 21791066
  55. a physiological function of ADAMTS5 in dermal fibroblasts is to maintain optimal versican content and PCM volume by continually trimming versican in hyaluronan-versican aggregates. PMID: 21828051
  56. A new VCAN/versican splice acceptor site mutation in a French Wagner family associated with vascular and inflammatory ocular features. PMID: 21738396
  57. Versican appears to be a central component of the outflow resistance, where it may organize GAGs and other ECM components to facilitate and control open flow channels in the trabecular meshwork. PMID: 21596823
  58. High versican is associated with metastatic gastrointestinal stromal tumors. PMID: 21244575
  59. Suggest that versican expression in in situ breast lesions may define different subtypes of intraductal carcinomas. PMID: 21185131
  60. both versican and CD44 play an important role regulating the behavior of malignant melanoma cells PMID: 21136024
  61. versican expression in the stromal compartment of cervical cancers results in reduced numbers of intraepithelial CD8-positive T cells and enhanced local invasion. PMID: 20729814
  62. V3 isoform of versican interferes with CD44 and the CD44-EGFR/ErbB2 interaction, altering the signaling pathways, such as ERK1/2 and p38 MAPK, that regulate cell proliferation and migration PMID: 21078678
  63. Stromal VCAN expression was associated with poorer overall and progression-free survival, platinum resistance, and increased MVDin ovarian neoplasms. PMID: 20619446
  64. miR-143 specifically binds to the 3'-untranslated region of versican mRNA. PMID: 20489207
  65. versican has an important role in the hyaluronan-dependent binding of monocytes to the ECM of lung fibroblasts stimulated with polyinosine-polycytidylic acid PMID: 19717812
  66. in contrast to IA, HSPG2 and CSPG2 do not associate with AAA. PMID: 20053631
  67. Syndecan-1 and versican expression status can serve as an indicator of prognosis in patients with epithelial ovarian cancer. PMID: 20204274
  68. The versican was only expressed in the developing intervertebral disc interspace. PMID: 19669783
  69. Aberrant production of excessive and disorganized extracellular matrix in uterine leiomyoma involves the activation of the TGF-beta3 signaling pathway and excessive production of GAG-rich versican variants. PMID: 19700613
  70. The intestinal-type gastric cancer susceptibility is associated with two amino acid changes of versican in the GAG-beta domain, which is critical for enhancement of cell proliferation and activation of EGFR signal pathway by versican PMID: 19655167
  71. All known isoforms were significantly overexpressed in breast cancer lesions, both at the mRNA and at the protein levels. A new alternatively spliced versican isoform, referred to as V4, was found and cloned. It was also upregulated in breast cancer. PMID: 19662655
  72. beta 1-Integrin-mediated glioma cell adhesion and free radical-induced apoptosis are regulated by binding to a C-terminal domain of PG-M/versican PMID: 11805102
  73. involved in the progression of melanomas and may be a reliable marker for clinical diagnosis PMID: 11839575
  74. Cleavage of the carboxyl tail from the G3 domain of aggrecan but not versican and identification of the amino acids involved in the degradation PMID: 11932252
  75. independent of the degree of vascularization, human adult tissues show a limited expression of versican isoforms V0, V2, and V3 PMID: 12221092
  76. CSPG2 contains a bona fide p53 binding site in its first intron and its expression highly correlates with TP53 dosage. Using in vitro and in vivo assays, we showed CSPG2 to be directly transactivated by p53. PMID: 12438652
  77. Synthesis and expression of mRNA encoding for different versican splice variants is related to the aggregation of human epithelial mesothelioma cells. PMID: 12553048
  78. versican/PG-M binds to hyaluronan PMID: 12888576
  79. All melanoma cell lines with an early or intermediate degree of differentiation expressed V0 and V1 versican isoforms, whereas V2 and V3 expression was shown only by undifferentiated cell lines. PMID: 12972299
  80. humoral immunity to versican as well as immunity to aggrecan may be of importance in the development of the spinal pathology characteristic of spondylarthropathies. PMID: 14558097
  81. the interaction between versican and hyaluronan in many tissues is stabilized by Link protein PMID: 14724283
  82. versican and tenascin have roles in preventing relapse of node-negative breast cancer PMID: 15073129
  83. Versican is 1 of the main genes upregulated after vascular injury. It is a main component in stented & nonstented restenotic lesions. It influences the assembly of ECM & elastic fiber fibrillogenesis of basic importance in vascular disease ECM remodeling. PMID: 15142969
  84. Malignant cells can actively influence the composition of the extracellular matrix through TGFbeta1 and other soluble factors. PMID: 15336555
  85. PG-M/versican binds to P-selectin glycoprotein ligand-1 and has a role in mediating leukocyte aggregation PMID: 15522894
  86. Cartilage link protein and versican did not bind directly to each other in solution yet formed ternary complexes with hyaluronan PMID: 15590670
  87. negative effect of TGFbeta1 on ADAMTS-1, -5, -9, and -15 coupled with increases in their inhibitor, TIMP-3 may aid the accumulation of versican in the stromal compartment of the prostate in BPH and prostate cancer PMID: 15599946
  88. versican is related to higher tumor recurrence rate and more advanced disease PMID: 15712181
  89. versican plays an important role in reducing oxidant injury through an enhancement of cell-matrix interaction PMID: 15748997
  90. Specific expression of versican in the anagen hair follicles suggests its importance to maintain the normal growing phase of humans. PMID: 15871917
  91. Results of RT-PCR analysis indicated that the c.4004-2 A-->G mutation activates a cryptic splice site, located 39 bp downstream from the authentic 3' splice acceptor site. PMID: 16043844
  92. This is the first report about the presence of various forms of versican in the anterior segment of the eye and the alterations in the mRNA patterns of these forms when cells are placed in culture PMID: 16110303
  93. We suggest that upregulation of versican in the infarcted myocardium may have a role in the inflammatory reaction, which mediates subsequent chemotaxis in the infarcted heart. PMID: 16311904
  94. Versican G3 domain promotes blood coagulation through suppressing the activity of tissue factor pathway inhibitor-1 PMID: 16431924
  95. although the exact interaction between tenascin-C and PG-M/versican remains not entirely clear, these two molecules appear to play significant roles in the PMID: 16493581
  96. The splice site mutation described here may lead to a complete lack of exon 8 in CSPG2 transcripts, which shortens the predicted protein by 1754 amino acids and leads to severe reduction of glycosaminoglycan attachment sites. PMID: 16636652
  97. the versican G3 domain regulates neuronal attachment, neurite outgrowth, and synaptic function of hippocampal neurons via EGFR-dependent and -independent signaling pathways PMID: 16648628
  98. Wagner disease and ERVR (erosive vitreoretinopathy) may belong to a largely overlooked group of diseases that are caused by mRNA isoform balance shifts, representing a novel disease mechanism. PMID: 16877430
  99. (Single nucleotide polymorphisms)SNPs in strong linkage disequilibrium and haplotypes constituting these SNPs in versican gene are associated with intracranial aneurysms(IAs). Variation in or near versican gene may play role in susceptibility to IAs. PMID: 16917090
  100. Epithelial versican expression was significantly higher in patients with lymph node metastasis of endometrial cancer PMID: 17065588

Show More

Hide All

Involvement in disease Wagner vitreoretinopathy (WGVRP)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Aggrecan/versican proteoglycan family
Tissue Specificity Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissu
Database Links

HGNC: 2464

OMIM: 118661

KEGG: hsa:1462

STRING: 9606.ENSP00000265077

UniGene: Hs.643801

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1