Recombinant Human Versican core protein(VCAN),partial

In Stock
Code CSB-EP025810HU(A5)
Product Type Recombinant Protein
Size US$2062Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P13611
Lead Time 3-7 business days
Relevance May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Source E.coli
Gene Names VCAN
Protein Names Chondroitin sulfate proteoglycan core protein 2
Expression Region 3089-3354aa
Tag Info N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Mol. Weight 47.6 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Involvement in disease Wagner vitreoretinopathy (WGVRP)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Aggrecan/versican proteoglycan family
Tissue Specificity Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissu
Database Links

HGNC: 2464

OMIM: 118661

KEGG: hsa:1462

STRING: 9606.ENSP00000265077

UniGene: Hs.643801

Related Products

VCAN Antibodies

VCAN Antibodies for Homo sapiens (Human)

VCAN Proteins

VCAN Proteins for Homo sapiens (Human)

VCAN ELISA Kit

VCAN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.