Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Aminoacylproline aminopeptidase; aminopeptidase P, cytosolic; APP1; Cytosolic aminopeptidase P; RP11 451M19.1; sAmp; Soluble aminopeptidase P; soluble; X Pro aminopeptidase 1; X prolyl aminopeptidase (aminopeptidase P) 1; X prolyl aminopeptidase (Aminopeptidase P) 1 soluble; X prolyl aminopeptidase 1; X prolyl aminopeptidase 1 soluble; X-Pro aminopeptidase 1; X-prolyl aminopeptidase 1; Xaa Pro aminopeptidase 1; Xaa-Pro aminopeptidase 1; XPNPEP 1; XPNPEP; xpnpep1; XPNPEPL; XPNPEPL1; XPP1_HUMAN
Species
Homo sapiens (Human)
Expression Region
2-623aa
Target Protein Sequence
PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human XPNPEP1 covers amino acids 2-623. This XPNPEP1 protein is expected to have a theoretical molecular weight of 85.8 kDa. The XPNPEP1 protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of XPNPEP1, making it easier to detect and purify the XPNPEP1 recombinant protein in the later stages of expression and purification.
Human Xaa-Pro aminopeptidase 1 (XPNPEP1), also known as aminopeptidase P, belongs to the M1 family of metallopeptidases. XPNPEP1 primarily functions in the hydrolysis of amino-terminal amino acid residues from peptides, particularly those with Xaa-Pro or Xaa-Ala sequences. It plays a role in the regulation of bioactive peptides and has been implicated in various physiological processes, including blood pressure regulation and sodium homeostasis. XPNPEP1 is expressed in tissues such as the kidney, where it participates in the degradation of peptides involved in these processes. Understanding XPNPEP1's functions contributes to insights into peptide metabolism and its potential implications for human health.
