Recombinant Human metapneumovirus Matrix protein(M)

In Stock
Code CSB-EP761526HDAM
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q6WB99
Lead Time 3-7 business days
Abbreviation M
Storage Buffer Tris-based buffer,50% glycerol
Species Human metapneumovirus (strain CAN97-83) (HMPV)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR
Research Area Signal Transduction
Source E.coli
Gene Names M
Protein Names Recommended name: Matrix protein
Expression Region 1-254aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 35.1 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a crucial role in virus assembly and budding. The matrix interacts with the RNP complex and this association serves two functions
Subcellular Location Virion, Host cytoplasm, Host nucleus, Host cell membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families Paramyxoviruses M protein family
Database Links

KEGG: vg:2799938

Related Products

M Antibodies

M Antibodies for Human metapneumovirus (strain CAN97-83) (HMPV)

M Proteins

M Proteins for Human metapneumovirus (strain CAN97-83) (HMPV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.