Recombinant Human metapneumovirus Matrix protein (M)

In Stock
Code CSB-YP761526HDAM
Abbreviation Recombinant Human metapneumovirus Matrix protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
M
Uniprot No.
Research Area
Tags & Cell Markers
Species
Human metapneumovirus (strain CAN97-83) (HMPV)
Source
Yeast
Expression Region
1-254aa
Target Protein Sequence
MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In the general approach to express the recombinant human metapneumovirus (HMPV) matrix (M) protein, a plasmid encoding the human metapneumovirus matrix protein (1-254aa) and the N-terminal 6xHis-tag is first constructed. The constructed plasmid is then introduced into yeast cells. Yeast cells-containing plasmid are screened and cultured under conditions that induce the protein expression. Lysing the cultured cells and purifying the resulting recombinant matrix protein through affinity purification. The SDS-PAGE analysis is conducted to confirm the presence of the recombinant matrix protein and assess its purity. Its purity is over 85%.

HMPV is a significant pathogen associated with respiratory tract infections, particularly affecting infants and young children [1]. The genome of HMPV consists of various genes, including the matrix (M), fusion (F), and nucleoprotein (N) genes [2]. The matrix protein of HMPV plays a crucial role in the infectivity of the virus, as demonstrated in a study that quantitated its presence [3]. The matrix protein and other viral genes like the polymerase gene can detect the presence of HMPV due to their low variation rate [4].

References:
[1] J. Williams, P. Harris, S. Tollefson, L. Halburnt-Rush, J. Pingsterhaus, K. Edwardset al., "Human metapneumovirus and lower respiratory tract disease in otherwise healthy infants and children", New England Journal of Medicine, vol. 350, no. 5, p. 443-450, 2004. https://doi.org/10.1056/nejmoa025472
[2] J. Greensill, P. McNamara, W. Dove, B. Flanagan, R. Smyth, & C. Hart, "Human metapneumovirus in severe respiratory syncytial virus bronchiolitis", Emerging Infectious Diseases, vol. 9, no. 3, p. 372-375, 2003. https://doi.org/10.3201/eid0903.020289
[3] S. Thammawat, T. Sadlon, P. Adamson, & D. Gordon, "Effect of sialidase fusion protein (das 181) on human metapneumovirus infection of hep-2 cells", Antiviral Chemistry and Chemotherapy, vol. 24, no. 5-6, p. 161-165, 2015. https://doi.org/10.1177/2040206616665971
[4] M. López-Huertas, I. Casas, B. Acosta-Herrera, M. García, M. Coiras, & P. Pérez-Breña, "Two rt-pcr based assays to detect human metapneumovirus in nasopharyngeal aspirates", Journal of Virological Methods, vol. 129, no. 1, p. 1-7, 2005. https://doi.org/10.1016/j.jviromet.2005.05.004

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a crucial role in virus assembly into filaments and budding. Early in infection, localizes in the nucleus where it may inhibit host cell transcription. Later in infection, traffics to the cytoplasm through the action of host CRM1 to associate with inclusion bodies, the site of viral transcription and replication. During virus assembly and budding, acts as a bridge between the nucleocapsid and the lipid bilayer.
Subcellular Location
Virion. Host cytoplasm. Host nucleus. Host cell membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Paramyxoviruses M protein family
Database Links

KEGG: vg:2799938

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*