Recombinant Human metapneumovirus Matrix protein (M)

In Stock
Code CSB-BP761526HDAM
Abbreviation Recombinant Human metapneumovirus Matrix protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
M
Uniprot No.
Research Area
Tags & Cell Markers
Species
Human metapneumovirus (strain CAN97-83) (HMPV)
Source
Baculovirus
Expression Region
1-254aa
Target Protein Sequence
MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process of producing recombinant human metapneumovirus Matrix protein (M) involves several steps beginning with isolating the target gene that corresponding to the 1-254aa of the M protein of HMPV. This gene is cloned into an expression vector with an N-terminal 10xHis-tag gene and C-terminal Myc-tag gene and then introduced into baculovirus cells through transfection. The baculovirus cells express the protein, which is harvested from the cell lysate. The protein is purified using affinity chromatography. Finally, the recombinant HMPV M protein's purity is determined by SDS-PAGE, reaching up to 85%.

The HMPV M protein plays a crucial role in viral assembly and immune response modulation. Structural analysis has revealed that the HMPV M protein is a key regulator of viral assembly [1]. The M protein of HMPV induces the maturation of antigen-presenting cells, contributing to the immune response [2]. The presence of the HMPV M protein has been detected in bronchiolar epithelial cells during HMPV infection, indicating its involvement in viral replication [3].

Studies have shown that virus-like particles (VLPs) containing the HMPV M protein can induce protective B and T cell responses, highlighting its importance in vaccine development [4]. The HMPV M protein has been utilized as a structural scaffold in the development of VLP-based vaccines, demonstrating its significance in vaccine design [5]. Furthermore, the HMPV Matrix protein has been studied in the context of viral morphogenesis, where it is involved in the formation of higher-order cellular assemblies and virion production [6][7].

References:
[1] G. Amarasinghe and R. Dutch, A calcium-fortified viral matrix protein, Structure, vol. 22, no. 1, p. 5-7, 2014. https://doi.org/10.1016/j.str.2013.12.008
[2] L. Aerts, C. Rhéaume, J. Carbonneau, S. Lavigne, C. Couture, M. Hamelinet al., Adjuvant effect of the human metapneumovirus (hmpv) matrix protein in hmpv subunit vaccines, Journal of General Virology, vol. 96, no. 4, p. 767-774, 2015. https://doi.org/10.1099/vir.0.000031
[3] G. Boivin, G. Serres, M. Hamelin, S. Côté, M. Argouin, G. Tremblayet al., An outbreak of severe respiratory tract infection due to human metapneumovirus in a long-term care facility, Clinical Infectious Diseases, vol. 44, no. 9, p. 1152-1158, 2007. https://doi.org/10.1086/513204
[4] R. Cox, J. Erickson, A. Hastings, J. Becker, M. Johnson, R. Cravenet al., Human metapneumovirus virus-like particles induce protective b and t cell responses in a mouse model, Journal of Virology, vol. 88, no. 11, p. 6368-6379, 2014. https://doi.org/10.1128/jvi.00332-14
[5] V. Cimica, H. Boigard, B. Bhatia, J. Fallon, A. Alimova, P. Gottliebet al., Novel respiratory syncytial virus-like particle vaccine composed of the postfusion and prefusion conformations of the f glycoprotein, Clinical and Vaccine Immunology, vol. 23, no. 6, p. 451-459, 2016. https://doi.org/10.1128/cvi.00720-15
[6] Y. Sabo, M. Ehrlich, & E. Bacharach, The conserved yagl motif in human metapneumovirus is required for higher-order cellular assemblies of the matrix protein and for virion production, Journal of Virology, vol. 85, no. 13, p. 6594-6609, 2011. https://doi.org/10.1128/jvi.02694-10
[7] M. Jumat, T. Huong, P. Wong, L. Loo, B. Tan, F. Fenwicket al., Imaging analysis of human metapneumovirus-infected cells provides evidence for the involvement of f-actin and the raft-lipid microdomains in virus morphogenesis, Virology Journal, vol. 11, no. 1, 2014. https://doi.org/10.1186/s12985-014-0198-8

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a crucial role in virus assembly into filaments and budding. Early in infection, localizes in the nucleus where it may inhibit host cell transcription. Later in infection, traffics to the cytoplasm through the action of host CRM1 to associate with inclusion bodies, the site of viral transcription and replication. During virus assembly and budding, acts as a bridge between the nucleocapsid and the lipid bilayer.
Subcellular Location
Virion. Host cytoplasm. Host nucleus. Host cell membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Paramyxoviruses M protein family
Database Links

KEGG: vg:2799938

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*