Recombinant Lithobates catesbeiana Saxiphilin,partial

In Stock
Code CSB-YP339158LQA(A5)
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P31226
Lead Time 3-7 business days
Relevance Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias SAX
Species Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
Research Area Others
Source Yeast
Expression Region 484-844aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 41.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Subcellular Location Secreted
Protein Families Transferrin family
Tissue Specificity Plasma. Highest levels of transcripts found in the liver, the lung, the pancreas and the brain.

Related Products

Proteins

Proteins for Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.