Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/mL can bind Anti-TACSTD2 recombinant antibody（CSB-RA023072MA1HU） The EC50 is 1.720-2.009 ng/mL.

Target Names

TACSTD2

Uniprot No.

XP_005543292.2

Alternative Names

/

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

31-274aa

Target Protein Sequence

QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTASAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Mol. Weight

28.9 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TACSTD2 functions as a cell surface marker overexpressed in numerous epithelial cancers, where it mediates intracellular calcium signaling and promotes tumor cell proliferation and metastasis. This recombinant protein spans residues 31–274, capturing the complete extracellular domain required for antibody recognition and receptor interactions, and demonstrates robust binding activity with an EC50 of 1.720–2.009 ng/mL against a validated anti-TACSTD2 antibody in functional ELISA. The quantified binding kinetics support its use in antibody development and validation workflows, including epitope mapping and affinity maturation studies targeting TACSTD2-positive tumors. Mammalian cell expression ensures native glycosylation and disulfide bond formation critical for authentic epitope presentation, while purity exceeding 95% and endotoxin levels below 1.0 EU/μg align with standards expected in cell-based assays investigating tumor cell adhesion, migration, and immune cell trafficking in cancer metastasis models.

Code	CSB-MP6581MOV
Abbreviation	Recombinant Cynomolgus monkey TACSTD2 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$102
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/ml can bind Anti-TACSTD2 recombinant antibody（CSB-RA023072MA1HU） The EC₅₀ is 1.720-2.009 ng/mL. Biological Activity Assay TACSTD2 Recombinant Monoclonal Antibody (CSB-RA023072MA1HU) captured on Protein A Chip can bind Recombinant Cynomolgus monkey TACSTD2 protein with an affinity constant of 0.135 nM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage