Recombinant Macaca fascicularis tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

In Stock
Code CSB-MP6581MOV
Abbreviation Recombinant Cynomolgus monkey TACSTD2 protein, partial (Active)
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/ml can bind Anti-TACSTD2 recombinant antibody(CSB-RA023072MA1HU) The EC50 is 1.720-2.009 ng/mL. Biological Activity Assay
  • TACSTD2 Recombinant Monoclonal Antibody (CSB-RA023072MA1HU) captured on Protein A Chip can bind Recombinant Cynomolgus monkey TACSTD2 protein with an affinity constant of 0.135 nM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/mL can bind Anti-TACSTD2 recombinant antibody(CSB-RA023072MA1HU) The EC50 is 1.720-2.009 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
31-274aa
Target Protein Sequence
QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTASAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Mol. Weight
28.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TACSTD2 functions as a cell surface marker overexpressed in numerous epithelial cancers, where it mediates intracellular calcium signaling and promotes tumor cell proliferation and metastasis. This recombinant protein spans residues 31–274, capturing the complete extracellular domain required for antibody recognition and receptor interactions, and demonstrates robust binding activity with an EC50 of 1.720–2.009 ng/mL against a validated anti-TACSTD2 antibody in functional ELISA. The quantified binding kinetics support its use in antibody development and validation workflows, including epitope mapping and affinity maturation studies targeting TACSTD2-positive tumors. Mammalian cell expression ensures native glycosylation and disulfide bond formation critical for authentic epitope presentation, while purity exceeding 95% and endotoxin levels below 1.0 EU/μg align with standards expected in cell-based assays investigating tumor cell adhesion, migration, and immune cell trafficking in cancer metastasis models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*