Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis BTLA at 2 μg/mL can bind Anti-BTLA recombinant antibody(CSB-RA773799MA1HU). The EC50 is 24.78-31.87 ng/mL.

Target Names

BTLA

Uniprot No.

A0A2K5W7M7

Alternative Names

B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; BTLA

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

31-152aa

Target Protein Sequence

KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRP

Mol. Weight

15.3 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

BTLA functions as an inhibitory immune checkpoint receptor that negatively regulates T-cell activation through interaction with herpesvirus entry mediator (HVEM), making it a target of interest in immuno-oncology research. This cynomolgus macaque ortholog, spanning the extracellular domain (residues 31–152) and expressed in mammalian cells to preserve native glycosylation and disulfide bonding, demonstrates quantifiable binding activity with an EC50 of 24.78–31.87 ng/mL against an anti-BTLA recombinant antibody in functional ELISA. The validated binding kinetics support its use in competitive inhibition assays for therapeutic antibody screening, epitope mapping studies to characterize candidate biologics targeting the BTLA–HVEM axis, and SPR or BLI experiments for affinity characterization of checkpoint modulators. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for ligand-binding assays and serves as a positive control in immune checkpoint interaction studies relevant to cancer immunotherapy development.

Code	CSB-MP4897MOV
Abbreviation	Recombinant Cynomolgus monkey BTLA protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis BTLA at 2 μg/ml can bind Anti-BTLA recombinant antibody(CSB-RA773799MA1HU). The EC₅₀ is 24.78-31.87 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage