Recombinant Macaca fascicularis LY6/PLAUR domain containing 3 (LYPD3), partial (Active)

In Stock
Code CSB-MP6357MOV1
Abbreviation Recombinant Cynomolgus monkey LYPD3 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis LYPD3 at 2 μg/ml can bind Anti-LYPD3 recombinant antibody (CSB-RA013263MA2HU). The EC50 is 0.8819-1.688 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis LYPD3 at 2 μg/mL can bind Anti-LYPD3 recombinant antibody (CSB-RA013263MA2HU). The EC50 is 0.8819-1.688 ng/mL.
Target Names
Uniprot No.
Alternative Names
LY6/PLAUR domain containing 3; LYPD3
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
32-293aa
Target Protein Sequence
LECYSCVQKADDGCSPHKMKTVKCAPGVDVCTEAVGAVETIHGQFSMGVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYNGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTISVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTSRQGAEH
Mol. Weight
28.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

LYPD3 serves as a cell surface marker implicated in tumor progression and metastasis, making it a relevant target for cancer biology investigations. This cynomolgus macaque ortholog, spanning residues 32–293 and produced in mammalian cells to preserve native glycosylation, demonstrates robust antibody-binding activity with an EC50 of 0.88–1.69 ng/mL in functional ELISA, confirming its suitability for antibody screening, epitope mapping studies, and immunoassay development. The protein meets the purity and endotoxin criteria typical for binding assays and cell-based functional studies, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin. Researchers developing therapeutic antibodies against LYPD3 or investigating its role in oncogenic signaling pathways can use this reagent as a positive control in ELISA platforms or as an immobilized ligand for characterizing antibody–antigen interactions in preclinical cancer research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*