Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Cynomolgus FCGR3A. The EC50 is 14.09-25.58 ng/ml.

Target Names

FCGR3A

Uniprot No.

Q8SPW2

Alternative Names

Low affinity immunoglobulin gamma Fc region receptor III-A; IgG Fc receptor III-A; Fc-gamma RIII-alpha (Fc-gamma RIII; Fc-gamma RIIIa; FcgammaRIIIa; CD16a; FCGR3A; FCGR3

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

17-208aa

Target Protein Sequence

GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ

Mol. Weight

26.9 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-Avi-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD16a mediates antibody-dependent cellular cytotoxicity by bridging IgG-opsonized targets to NK cells and macrophages, making it a critical node in therapeutic antibody efficacy and immune surveillance studies. This cynomolgus macaque ortholog, spanning the extracellular domain (aa 17–208) and expressed in mammalian cells to preserve native glycosylation patterns, demonstrates quantifiable binding to an anti-FCGR3A antibody with an EC50 of 14.09–25.58 ng/ml in functional ELISA, confirming conformational integrity suitable for ligand-binding assays, competitive inhibition screens, and therapeutic antibody epitope mapping. The site-specific biotinylation via C-terminal Avi-tag enables direct immobilization in SPR and BLI platforms for affinity characterization of antibody-Fc variants or blocking candidates without compromising the receptor's binding interface. Purity exceeding 95% and endotoxin below 1.0 EU/μg align with standards expected in antibody-dependent cellular cytotoxicity mechanism studies and biologic inhibitor screening workflows.

Target Background

Function

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Binds IgG1 and IgG2.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Tissue Specificity

Lymphocytes and monocytes.

Database Links

KEGG: mcf:102140945

UniGene: Mfa.6130

Code	CSB-MP854680MOV-B
Abbreviation	Recombinant Cynomolgus monkey FCGR3A protein, partial, Biotinylated (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Cynomolgus FCGR3A. The EC₅₀ is 14.09-25.58 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Low affinity immunoglobulin gamma Fc region receptor III (FCGR3A), partial, Biotinylated (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage