Recombinant Macaca fascicularis Low affinity immunoglobulin gamma Fc region receptor III (FCGR3A), partial, Biotinylated (Active)

In Stock
Code CSB-MP854680MOV-B
Abbreviation Recombinant Cynomolgus monkey FCGR3A protein, partial, Biotinylated (Active)
MSDS
Size $140
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Cynomolgus FCGR3A. The EC50 is 14.09-25.58 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-FCGR3A antibody (CSB-RA008543MA2HU) at 2 μg/ml can bind Biotinylated Cynomolgus FCGR3A. The EC50 is 14.09-25.58 ng/ml.
Target Names
Uniprot No.
Alternative Names
Low affinity immunoglobulin gamma Fc region receptor III-A; IgG Fc receptor III-A; Fc-gamma RIII-alpha (Fc-gamma RIII; Fc-gamma RIIIa; FcgammaRIIIa; CD16a; FCGR3A; FCGR3
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
17-208aa
Target Protein Sequence
GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ
Mol. Weight
26.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD16a mediates antibody-dependent cellular cytotoxicity by bridging IgG-opsonized targets to NK cells and macrophages, making it a critical node in therapeutic antibody efficacy and immune surveillance studies. This cynomolgus macaque ortholog, spanning the extracellular domain (aa 17–208) and expressed in mammalian cells to preserve native glycosylation patterns, demonstrates quantifiable binding to an anti-FCGR3A antibody with an EC50 of 14.09–25.58 ng/ml in functional ELISA, confirming conformational integrity suitable for ligand-binding assays, competitive inhibition screens, and therapeutic antibody epitope mapping. The site-specific biotinylation via C-terminal Avi-tag enables direct immobilization in SPR and BLI platforms for affinity characterization of antibody-Fc variants or blocking candidates without compromising the receptor's binding interface. Purity exceeding 95% and endotoxin below 1.0 EU/μg align with standards expected in antibody-dependent cellular cytotoxicity mechanism studies and biologic inhibitor screening workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Binds IgG1 and IgG2.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Lymphocytes and monocytes.
Database Links

KEGG: mcf:102140945

UniGene: Mfa.6130

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*