Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)

In Stock
Code CSB-MP6176MOV
Abbreviation Recombinant Cynomolgus monkey LTBR protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 11.83-14.23 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 11.83-14.23 ng/ml.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
28-229aa
Target Protein Sequence
SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT
Mol. Weight
23.6kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Lymphotoxin beta receptor mediates critical signals in lymphoid organogenesis and immune homeostasis, making its extracellular domain a key target for dissecting TNFSF14/LIGHT interactions in primate models. This cynomolgus macaque LTBR fragment spanning residues 28–229 demonstrates quantifiable binding to human TNFSF14 with an EC50 of 11.83–14.23 ng/ml in functional ELISA, providing a validated reagent for ligand-binding assays, competitive inhibition studies, and blocking antibody screening in translational research. Mammalian cell expression preserves the native glycosylation and disulfide architecture essential for physiological receptor conformation, supporting its use in therapeutic antibody epitope mapping, SPR-based affinity characterization, and small-molecule inhibitor screening campaigns. The protein meets the purity and endotoxin criteria typical for quantitative binding assays, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin, aligning with standards expected in drug discovery workflows targeting the lymphotoxin pathway.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*