Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)

In Stock
Code CSB-MP6176MOVd9
Abbreviation Recombinant Cynomolgus monkey LTBR protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/ml can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B). The EC50 is 4.316-4.875 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/mL can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B). The EC50 is 4.316-4.875 ng/mL.
Target Names
Uniprot No.
Alternative Names
Lymphotoxin beta receptor; LTBR
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
28-229aa
Target Protein Sequence
SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT
Mol. Weight
51.2 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Lymphotoxin beta receptor mediates critical signals in lymphoid organogenesis and immune homeostasis, making its extracellular domain a key target for dissecting TNF superfamily interactions in primate models. This mammalian-expressed construct spanning residues 28–229 demonstrates quantifiable binding to biotinylated human TNFSF14 with an EC50 of 4.316–4.875 ng/mL in functional ELISA, providing a validated reagent for ligand-receptor interaction studies, competitive inhibition assays, and blocking antibody screening in cynomolgus macaque research. The C-terminal hFc1 tag facilitates immobilization in surface plasmon resonance and biolayer interferometry platforms, supporting affinity characterization and therapeutic antibody epitope mapping with direct relevance to translational primate pharmacology. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in functional binding assays and antibody validation workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*