Recombinant Macaca fascicularis Platelet-derived growth factor receptor alpha (PDGFRA) ,partial (Active)

In Stock
Code CSB-MP7222MOV
Abbreviation Recombinant Cynomolgus monkey PDGFRA protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis PDGFRA at 2 μg/ml can bind Anti-PDGFRA recombinant antibody (CSB-RA017712MA1HU). The EC50 is 1.368-1.519 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis PDGFRA at 2 μg/mL can bind Anti-PDGFRA recombinant antibody (CSB-RA017712MA1HU). The EC50 is 1.368-1.519 ng/mL.
Target Names
Uniprot No.
Alternative Names
Platelet-derived growth factor receptor alpha; PDGF-R-alpha; PDGFR-alpha; EC 2.7.10.1; Alpha platelet-derived growth factor receptor; Alpha-type platelet-derived growth factor receptor
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
24-524aa
Target Protein Sequence
QLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVKEMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGMPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRDRSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSE
Mol. Weight
57.6 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

PDGFRA signaling drives mesenchymal cell proliferation and vascular development, yet recombinant extracellular domains often suffer from misfolding that compromises ligand recognition and antibody epitope presentation. This protein spans residues 24–524, capturing the complete immunoglobulin-like domains responsible for PDGF binding, and demonstrates quantifiable antibody recognition with an EC50 of 1.368–1.519 ng/mL in functional ELISA, confirming that native epitopes remain accessible. Mammalian expression preserves the post-translational modifications critical for proper domain folding, making this reagent suitable for therapeutic antibody epitope mapping, competitive inhibition screening of PDGFRA-targeting biologics, and ligand-binding assays by ELISA, SPR, or BLI. The combination of >95% purity and <1.0 EU/μg endotoxin meets the quality thresholds commonly required for high-sensitivity binding studies and serves as a validated positive control in receptor-ligand interaction platforms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*