Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis PDGFRA at 2 μg/mL can bind Anti-PDGFRA recombinant antibody (CSB-RA017712MA1HU). The EC50 is 1.368-1.519 ng/mL.

Target Names

PDGFRA

Uniprot No.

Q0PW86

Alternative Names

Platelet-derived growth factor receptor alpha; PDGF-R-alpha; PDGFR-alpha; EC 2.7.10.1; Alpha platelet-derived growth factor receptor; Alpha-type platelet-derived growth factor receptor

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

24-524aa

Target Protein Sequence

QLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVKEMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGMPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRDRSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSE

Mol. Weight

57.6 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

PDGFRA signaling drives mesenchymal cell proliferation and vascular development, yet recombinant extracellular domains often suffer from misfolding that compromises ligand recognition and antibody epitope presentation. This protein spans residues 24–524, capturing the complete immunoglobulin-like domains responsible for PDGF binding, and demonstrates quantifiable antibody recognition with an EC50 of 1.368–1.519 ng/mL in functional ELISA, confirming that native epitopes remain accessible. Mammalian expression preserves the post-translational modifications critical for proper domain folding, making this reagent suitable for therapeutic antibody epitope mapping, competitive inhibition screening of PDGFRA-targeting biologics, and ligand-binding assays by ELISA, SPR, or BLI. The combination of >95% purity and <1.0 EU/μg endotoxin meets the quality thresholds commonly required for high-sensitivity binding studies and serves as a validated positive control in receptor-ligand interaction platforms.

Code	CSB-MP7222MOV
Abbreviation	Recombinant Cynomolgus monkey PDGFRA protein, partial (Active)
MSDS	MSDS Datasheet
Size	$118
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis PDGFRA at 2 μg/ml can bind Anti-PDGFRA recombinant antibody (CSB-RA017712MA1HU). The EC₅₀ is 1.368-1.519 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Platelet-derived growth factor receptor alpha (PDGFRA) ,partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage