Home
Active Protein
Other
Recombinant Macaca fascicularis Delta-like protein 3 (DLL3), partial (Active)

Recombinant Macaca fascicularis Delta-like protein 3 (DLL3), partial (Active)

^{In Stock}

Code	CSB-MP3536MOV
Abbreviation	Recombinant Cynomolgus monkey DLL3 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/ml can bind Anti-DLL3 Recombinant Antibody（CSB-RA882142A1HU）, the EC₅₀ is 1.625-2.702 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/mL can bind Anti-DLL3 Recombinant Antibody（CSB-RA882142A1HU）, the EC₅₀ is 1.625-2.702 ng/mL.

Target Names

DLL3

Uniprot No.

A0A2K5WSR4

Research Area

Cell Biology

Molecular Characterization

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

27-490aa

Target Protein Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCELPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCLEGWTGPLCMVPVSTSSCLGLRGPSSTTTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRNCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGVSALPAAPPGLRPGDPQR

Mol. Weight

50.6 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CUSABIO's product CSB-MP3536MOV is an active recombinant Delta-like protein 3 (DLL3) tagged the 6xHis at the C-terminus. It is expressed in mammalian cells with the gene fragment mapping within amino acids 27-490 of Macaca fascicularis DLL3 protein. Its bioactivity has been validated by binding to the anti-DLL3 antibody in a functional ELISA. The EC₅₀ is 1.625-2.702 ng/mL. Its purity is over 85% measured by SDS-PAGE. On the gel, this protein migrated to the molecular weight band of approximately 55 kDa. The endotoxin content of the recombinant protein was less than 1.0 EU/ug determined by the LAL method. This DLL3 protein is available. DLL3 is a negative Notch regulator and is expressed during brain development where it modulates somitogenesis. It is not expressed on the surface of normal cells but is highly expressed on the surface of tumor cells. Aberrant DLL3 expression has been found in most small cell lung cancer (SCLC) cells.