Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Macaca fascicularis TNFSF13B protein (CSB-MP6724MOV). The EC50 is 7.254-13.83 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13 protein (CSB-MP023989HU). The EC50 is 11.13-18.97 ng/mL. ③Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC50 is 10.67-12.46 ng/mL. ④Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1-B). The EC50 is 0.6374-1.431 ng/mL.

Target Names

TNFRSF13B

Uniprot No.

G7PTR7

Alternative Names

Tumor necrosis factor receptor superfamily member 13B; Transmembrane activator and CAML interactor; EGM_07468

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

2-160aa

Target Protein Sequence

SGLGRSRRGGRSRVDQEERSPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKAICNHQSQRTCATFCRSLNCRKEQGRFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGSEHRGSEASPALPGLKLSADQL

Mol. Weight

19.2 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TNFRSF13B (TACI) mediates B-cell survival and class-switch recombination by binding BAFF and APRIL, making it a critical node in humoral immunity and a target in autoimmune disease and B-cell malignancy research. This cynomolgus macaque ortholog, spanning residues 2–160 of the extracellular domain and produced in mammalian cells to preserve native glycosylation and disulfide architecture, demonstrates quantified binding to both cynomolgus TNFSF13B (EC50 7.3–13.8 ng/mL) and human TNFSF13 and TNFSF13B ligands (EC50 values ranging 0.64–19.0 ng/mL across isoforms), confirming cross-species receptor-ligand interaction fidelity suitable for competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening in translational primate models. The low-picomolar to nanomolar EC50 range supports sensitive detection in ELISA-based ligand-binding studies and affinity characterization by surface plasmon resonance or biolayer interferometry. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% align with standards expected in functional immunoassays where cytokine contamination would confound B-cell activation readouts.

Code	CSB-MP6427MOV
Abbreviation	Recombinant Cynomolgus monkey TNFRSF13B protein, partial (Active)
MSDS	MSDS Datasheet
Size	$114
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Macaca fascicularis TNFSF13B protein (CSB-MP6724MOV). The EC₅₀ is 7.254-13.83 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Human TNFSF13 protein (CSB-MP023989HU). The EC₅₀ is 11.13-18.97 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Human TNFSF13B protein (CSB-MP897523HU1). The EC₅₀ is 10.67-12.46 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/ml can bind Human TNFSF13B protein (CSB-MP897523HU1-B). The EC₅₀ is 0.6374-1.431 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 13B, partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage