Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Prkab1

Uniprot No.

Q9R078

Research Area

Metabolism

Alternative Names

Prkab15'-AMP-activated protein kinase subunit beta-1; AMPK subunit beta-1; AMPKb

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

2-270aa

Target Protein Sequence

GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).

Gene References into Functions

activation of AMPK at early stage of adipogenesis is involved in the anti-adipogenesis effect of Red Pepper Seed extract. PMID: 29316805
in the absence of the tumor suppressor p53, germline genetic deletion of AMPK beta1 accelerates the appearance of a T-cell lymphoma that reduces lifespan compared to p53 deficiency alone. PMID: 28544264
In lipid-laden macrophages, Ampk activation decreased cholesterol content (foam cell formation) and increased cholesterol efflux to HDL and apoA-I, effects that occurred in an Ampk beta1-dependent manner. PMID: 25773887
Salicylate activates the AMP-activated protein kinase (AMPK) by binding at the A-769662 drug binding site on the AMPK beta1-subunit PMID: 25940306
AMPK beta1beta2 have a role in preventing myopathy due to loss of capillary density in nonpostural muscles PMID: 24522207
The aim of this study was to determine whether activation of AMPK by acute renal ischemia influences the severity of renal ischemia-reperfusion injury. PMID: 22253816
AMPK beta1 protects macrophages from inflammation under high lipid exposure from a high fat diet. beta1(-/-) macrophages displayed increased levels of diacylglycerol and markers of inflammation. PMID: 22080866
cisplatin-triggered activation of AMPK and subsequent suppression of mTOR activity can induce an autophagic response that protects tumour cells from cisplatin-mediated apoptotic death PMID: 20196784
Data show that beta1beta2M-KO mice are physically inactive and have a drastically impaired capacity for treadmill running that is associated with reductions in skeletal muscle mitochondrial content. PMID: 21896769
Phosphorylation of AMPK by Ulk1 represents a negative feedback circuit. PMID: 21460634
AMPK negatively regulates Nox4-dependent activation of p53 and podocytes apoptosis in diabetes. PMID: 20861022
AMPK negatively regulates lipid-induced inflammation, which acts through SIRT1, thereby contributing to the protection against obesity, inflammation, and insulin resistance PMID: 20421294
Germline deletion of either AMPK beta1 or beta2 subunit isoforms resulted in reduced trabecular bone density and mass, but without effects on osteoclast (OC) or osteoblast (OB) numbers. PMID: 19723702
The loss of AMPK beta1 reduces food intake and protects against the deleterious effects of an obesity-inducing diet. PMID: 19892703
metformin and AMPK have a previously unrecognized role in regulating the circadian rhythm PMID: 17525164
regulation of FOXO3 by AMPK may play a crucial role in fine tuning gene expression programs that control energy balance and stress resistance in cells throughout life PMID: 17711846
metformin-mediated AMPK activation leads to inhibition of mTOR and a reduction in translation initiation PMID: 18006825
AMPK activation appears to restrain the energy depletion and oxidative stress caused by lipolysis PMID: 18390901
Regulation of erythrocyte survival by AMPK is reported. PMID: 19050047
AMPK integrates growth factor signaling with cell cycle control to regulate brain development PMID: 19217427

Hide All

Protein Families

5'-AMP-activated protein kinase beta subunit family

Database Links

KEGG: mmu:19079

STRING: 10090.ENSMUSP00000031486

UniGene: Mm.458152

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP889918MO
MSDS	MSDS
Size	US$388
	Order now
Promotion
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage