Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)

In Stock
Code CSB-EP889918MO
Abbreviation Recombinant Mouse Prkab1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
Prkab15'-AMP-activated protein kinase subunit beta-1; AMPK subunit beta-1; AMPKb
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
2-270aa
Target Protein Sequence
GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
Gene References into Functions
  1. activation of AMPK at early stage of adipogenesis is involved in the anti-adipogenesis effect of Red Pepper Seed extract. PMID: 29316805
  2. in the absence of the tumor suppressor p53, germline genetic deletion of AMPK beta1 accelerates the appearance of a T-cell lymphoma that reduces lifespan compared to p53 deficiency alone. PMID: 28544264
  3. In lipid-laden macrophages, Ampk activation decreased cholesterol content (foam cell formation) and increased cholesterol efflux to HDL and apoA-I, effects that occurred in an Ampk beta1-dependent manner. PMID: 25773887
  4. Salicylate activates the AMP-activated protein kinase (AMPK) by binding at the A-769662 drug binding site on the AMPK beta1-subunit PMID: 25940306
  5. AMPK beta1beta2 have a role in preventing myopathy due to loss of capillary density in nonpostural muscles PMID: 24522207
  6. The aim of this study was to determine whether activation of AMPK by acute renal ischemia influences the severity of renal ischemia-reperfusion injury. PMID: 22253816
  7. AMPK beta1 protects macrophages from inflammation under high lipid exposure from a high fat diet. beta1(-/-) macrophages displayed increased levels of diacylglycerol and markers of inflammation. PMID: 22080866
  8. cisplatin-triggered activation of AMPK and subsequent suppression of mTOR activity can induce an autophagic response that protects tumour cells from cisplatin-mediated apoptotic death PMID: 20196784
  9. Data show that beta1beta2M-KO mice are physically inactive and have a drastically impaired capacity for treadmill running that is associated with reductions in skeletal muscle mitochondrial content. PMID: 21896769
  10. Phosphorylation of AMPK by Ulk1 represents a negative feedback circuit. PMID: 21460634
  11. AMPK negatively regulates Nox4-dependent activation of p53 and podocytes apoptosis in diabetes. PMID: 20861022
  12. AMPK negatively regulates lipid-induced inflammation, which acts through SIRT1, thereby contributing to the protection against obesity, inflammation, and insulin resistance PMID: 20421294
  13. Germline deletion of either AMPK beta1 or beta2 subunit isoforms resulted in reduced trabecular bone density and mass, but without effects on osteoclast (OC) or osteoblast (OB) numbers. PMID: 19723702
  14. The loss of AMPK beta1 reduces food intake and protects against the deleterious effects of an obesity-inducing diet. PMID: 19892703
  15. metformin and AMPK have a previously unrecognized role in regulating the circadian rhythm PMID: 17525164
  16. regulation of FOXO3 by AMPK may play a crucial role in fine tuning gene expression programs that control energy balance and stress resistance in cells throughout life PMID: 17711846
  17. metformin-mediated AMPK activation leads to inhibition of mTOR and a reduction in translation initiation PMID: 18006825
  18. AMPK activation appears to restrain the energy depletion and oxidative stress caused by lipolysis PMID: 18390901
  19. Regulation of erythrocyte survival by AMPK is reported. PMID: 19050047
  20. AMPK integrates growth factor signaling with cell cycle control to regulate brain development PMID: 19217427

Show More

Hide All

Protein Families
5'-AMP-activated protein kinase beta subunit family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*