Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial

In Stock
Code CSB-EP005386MOa2
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Chrna1
Uniprot No. P04756
Research Area Others
Alternative Names Chrna1; Acra; Acetylcholine receptor subunit alpha
Species Mus musculus (Mouse)
Source E.coli
Expression Region 21-230aa
Target Protein Sequence SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 40.5kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Gene References into Functions
  1. A triad of residues aligning to Thr-152, Glu-209, and Lys-211 in Htr3, appear to be involved in side-chain interactions near binding sites in Htr3a (subunit alpha) and muscle-type Chrna1. Data suggest that mutating Htr3a triad to that of Chrna1 increases binding affinity of nicotine to Htr3a. (Htr3 = 5-hydroxytryptamine/serotonin receptor; Chrna1 = cholinergic receptor nicotinic alpha polypeptide 1) PMID: 29298898
  2. The results indicate that in the absence of the alpha1-nAChR subunit, clusters of nAChRs coupled to SK2 potassium channels as well as functional efferent synapses did form, showing that alpha1 is not necessary for these processes to take place. PMID: 27098031
  3. Findings suggest the possible role of controlling localised inflammatory response by parasympathetic cholinergic nerves through a1nAChRs of inflammation sites. PMID: 26778394
  4. This study demonstrates that genes coding for CHRNA1 subunits may contain variants associated with statin-induced ADRs. PMID: 22688219
  5. Chrna1 was co-purified with nicotinic acetylcholine receptor (AChR) in C2C12 myotubes. In addition, Stau1 was found to interact with Chrna1 mRNA, and knocking down of Stau1 by RNAi resulted in defective AChR clustering. PMID: 22884571
  6. These results suggest that in skeletal muscle cells, neural activity reduces the molar ratio of YB-1 relative to its binding AChR alpha mRNA, leading to an increase of ribosome binding to the mRNA, and thus activating translation. PMID: 21964286
  7. Chrna1 could be the first transcriptional target of atonal homolog 1 in the inner ear PMID: 17961150
  8. The nAChRalpha1 gene plays a significant role at the artery wall, and reducing its expression decreases aortic plaque development. PMID: 20810113
  9. These data identify caveolin-3 as a critical component of the signaling machinery that drives nicotinic acetylcholine receptor clustering and controls neuromuscular junction function. PMID: 19940021
  10. These two residues (and homologous sites in epsilon; subunit) are not involved in specific interactions with nicotinic agonist, and they affect activation of nicotinic receptor by shaping overall structure of agonist binding site. PMID: 12411516
  11. In murine muscle-type AChR alpha transmembrane 3 domain, tryptophan substitution at positions Phe-284, Ala-287, and Ile-290 produces a significant increase in normalized macroscopic response in channel gating, primarily the channel closing rate. PMID: 14705933
  12. the interaction between alpha AChR M1 and M2 domains plays a key role in channel gating PMID: 17028140
  13. Receptors with neutral side chains at position 89 function well, if side chain is less perturbing than amide of asparagine (nitro or keto groups allow function) or if a compensating backbone mutation is introduced to relieve unfavorable electrostatics. PMID: 17223685
  14. HDAC4 is a neural activity-regulated deacetylase and a key signaling component that relays neural activity to the muscle transcriptional machinery through Dach2, myogenin, and nAChR PMID: 17873280
  15. Data suggest that the alpha1 nicotinic acetylcholine receptor might play an important role in mechanotransduction of tensile stress loading on maxillofacial skeletal myocytes. PMID: 18163199
  16. In S269I, mutant the peak-current amplitude decreases along trains of nearly saturating ACh pulses delivered at physiologically relevant frequencies, consistent with enhanced entry into desensitization in congenital myasthenic syndrome. PMID: 19171769
  17. The local anaesthetics proadifen and adiphenine inhibit nicotinic receptors by different molecular mechanisms. PMID: 19422391
  18. In this mouse experiemntal myasthenia gravis study demonstrated that Acetylcholine receptor-alpha1 subunit expression was increase with varying disease severity. PMID: 19609914
  19. fibroblast nicotinic receptor alpha1 binds urokinase and promotes renal fibrosis PMID: 19690163

Show More

Hide All

Subcellular Location Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily
Database Links

KEGG: mmu:11435

STRING: 10090.ENSMUSP00000028515

UniGene: Mm.4583

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1