Recombinant Mouse Acyl-CoA-binding protein (Dbi)

Code CSB-YP006519MObo
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Dbi
Uniprot No.
Research Area
Metabolism
Alternative Names
Diazepam-binding inhibitor DBI Endozepine EP ACBP
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
2-87aa
Target Protein Sequence
SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
12.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Gene References into Functions
  1. DBI is expressed in stem cells in all neurogenic niches of the postnatal brain. DBI regulates the balance between preserving the stem cell pool and neurogenesis. Specifically, DBI dampens GABA activity in stem cells, thereby sustaining the proproliferative effect of physical exercise and enriched environment. PMID: 28343864
  2. ACBP increases the activity of ceramide synthase 2 (CerS2) by more than 2-fold and CerS3 activity by 7-fold. ACBP binds very-long-chain acyl-CoA esters, which is required for its ability to stimulate CerS activity. PMID: 28320857
  3. Mice with conditional targeting of the Acbp gene in the epidermis recapitulate this phenotype, whereas generation of an artificial epidermal barrier during gland development reverses the phenotype PMID: 26142722
  4. This study demonistrated that a novel role for ACBP in brain lipid metabolism. PMID: 25598214
  5. Acyl-CoA binding protein and epidermal barrier function. [review] PMID: 24080521
  6. ACBP is required for production of VLC-FFA for stratum corneum and for maintaining normal epidermal barrier function PMID: 22829653
  7. It was concluded that acyl-CoA binding protein via aquaporin 3 is necessary for intact urine concentrating ability through efflux over the basolateral membrane of the collecting duct. PMID: 22237802
  8. Diazepam binding inhibitor promotes progenitor proliferation in the postnatal SVZ by reducing GABA signaling. PMID: 22226357
  9. lack of ACBP interferes with the normal metabolic adaptation to weaning and leads to delayed induction of the lipogenic gene program in the liver PMID: 21106527
  10. Acyl-CoA binding protein gene ablation induces pre-implantation embryonic lethality in mice PMID: 20559753
  11. Acute food deprivation reduces expression of diazepam-binding inhibitor in mouse glial cells. PMID: 20219854
  12. the present study revealed a definite existence of DBI in non-neuronal supporting cells in both the central and peripheral nervous systems. PMID: 12002608
  13. PPRE in intron 1 of the ACBP gene is a bona fide PPARgamma-response element. PMID: 12015306
  14. A functionally active recombinant ACBP with amino acid sequence identical to the native protein interacts preferentially with anionic phospholipid-rich, highly curved membranes to facilitate transfer of ACBP-bound ligands. PMID: 12173941
  15. ACBP was the most potent intracellular fatty acyl CoA binding protein in differentially modulating the activity of microsomal ACAT to form cholesteryl esters independent of cholesterol binding/transfer ability PMID: 12518025
  16. Results identify new acyl-CoA binding protein transcripts in human and mouse tissues, generated by alternative first exon usage. PMID: 16055366
  17. Acbp plays a role in triacylglycerol biosynthesis, and that regulation of this process is important for proper hair and skin development and maintenance in the mouse. PMID: 16902415
  18. Endogenously overexpressed DBI impairs hippocampus-dependent learning without anxiety or proconflict behavior. PMID: 17150371

Show More

Hide All

Subcellular Location
Endoplasmic reticulum. Golgi apparatus.
Protein Families
ACBP family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*