Recombinant Mouse C-C motif chemokine 25(Ccl25),partial

Code CSB-EP004789MO1
Product Type Recombinant Protein
Size US$2466
Uniprot No. O35903
Relevance Potentially involved in T-cell development. Recombinant protein shows chotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Chemokine TECKSmall-inducible cytokine A25Thymus-expressed chemokine
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Research Area Others
Source E.coli
Gene Names Ccl25
Expression Region 25-144aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 18.0kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Subcellular Location Secreted
Protein Families Intercrine beta (chemokine CC) family
Tissue Specificity Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Database Links

KEGG: mmu:20300

STRING: 10090.ENSMUSP00000024004

UniGene: Mm.7275

Pathway Chemokine signaling pathway

Related Products

Ccl25 Antibodies

Ccl25 Antibodies for Mus musculus (Mouse)

Ccl25 Proteins

Ccl25 Proteins for Mus musculus (Mouse)

Ccl25 ELISA Kit

Ccl25 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.