Recombinant Mouse C-C motif chemokine 25 (Ccl25), partial

Code CSB-EP004789MO1
Abbreviation Recombinant Mouse Ccl25 protein, partial
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ccl25; Scya25; Teck; C-C motif chemokine 25; Chemokine TECK; Small-inducible cytokine A25; Thymus-expressed chemokine
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-144aa
Target Protein Sequence
GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Gene References into Functions
  1. these results showed a site- and cell-specific expressions of Ccl25 and its receptor Ccr9 within both maternal and embryonic compartments of implantation sites and suggested a role in inducing specific Ccr9+ leukocytes at the maternal-fetal interface during the initial steps of embryo implantation in the mouse model PMID: 29154408
  2. MicroRNA-205 maintains T cell development following stress by regulating Foxn1 and its two regulated targets, stem cell factor and ccl25, following stress. PMID: 27646003
  3. CCR9 and CCL25 expressions are induced in the early stages of airway inflammation and they have an important role modulating eosinophils and lymphocytes recruitment at the first stages of inflammatory process PMID: 27795621
  4. TECK was shown to be expressed by osteoblasts, and its receptor, CCR9, by osteoclast precursors. TECK increased P. gingivalis LPS-induced osteoclast numbers in an in vitro osteoclast formation assay using osteoclast precursors. T PMID: 26921718
  5. CCR9/CCL25 is involved in acute skin transplantation rejection and anti-CCL25 strategies might be useful in preventing acute rejection. PMID: 23456208
  6. Accumulated CD11b(+) macrophages are critical for activating hepatic stellate cells through the CCR9/CCL25 axis and therefore promote liver fibrosis. PMID: 23460364
  7. The results revealed that during an allergic reaction, CCL25 drives IL-17 gammadelta T-cell mobilization to inflamed tissue via alpha4beta7 integrin and modulates IL-17 levels. PMID: 22539297
  8. CCL25/CCR9 interactions regulate inflammatory immune responses in the large intestinal mucosa by balancing different subsets of dendritic cells. PMID: 21283540
  9. Characterization of mouse CCX-CKR, a receptor for the lymphocyte-attracting chemokines TECK/mCCL25, SLC/mCCL21 and MIP-3beta/mCCL19: comparison to human CCX-CKR. (CCX-CKR) PMID: 11981810
  10. in vivo neutralization of the CCR9 ligand, CCL25, reduced the ability of activated CCR9(+) CD8alphabeta(+) lymphocytes cells to populate the small-intestinal epithelium PMID: 12393847
  11. role of CCL25 in the generation of the small-intestinal CD8alpha alpha(+)CD3(+) intraepithelial lymphocyte compartment PMID: 12442331
  12. chemokine (C-C motif) ligand 25 may thus play an important role in the adherence of mucosal lymphocytes to the microvessels of the small intestine but not the colon under uninflamed as well as inflamed conditions PMID: 14592943
  13. Neonatal CD8+ splenocytes uniformly express alpha(E) integrin and exhibit a high responsiveness to CC chemokine ligand 25. With increasing age, the frequency of CD8+ alpha(E) integrin(+) splenocytes decreases, roughly correlating with thymic involution. PMID: 15187103
  14. Epithelial cells and venular endothelium of small intestine are immunologically positive for CCL25, a chemokine which plays a direct role in intestinal homing of IgA antibody-secreting cells by mediating their extravasation into intestinal lamina propria. PMID: 15356112
  15. Chemokine CCL25 enhances CD103-mediated adhesion to E-cadherin. PMID: 15681774
  16. demonstrate a unique pattern of regulation for CCL25 and suggest a role for caudal type homeo box proteins in regulating CCL25 transcription PMID: 16517733
  17. Intracellular signaling required for Ccl25-stimulated T cell adhesion mediated by the integrin alpha4beta1. PMID: 17510295
  18. CCL25 is indispensable for CD8 T cells trafficking to the small intestine. PMID: 17548595
  19. Demonstrate development of intestinal inflammation in Tnf(DeltaARE) mice is critically dependent on beta7 integrin-mediated T-lymphocyte recruitment. the function of the CCL25/CCR9 axis appears dispensable in this model. PMID: 18439426
  20. CCL25 increases thymopoiesis after androgen withdrawal PMID: 18694999
  21. Ovarian CC chemokine thymus-expressed chemokine (TECK) appears to be a chemoattractant for CD8 alpha alpha-positive cells. PMID: 19109193

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Tissue Specificity
Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*