Recombinant Mouse C-C motif chemokine 4 (Ccl4)

In Stock
Code CSB-EP004797MO
Abbreviation Recombinant Mouse Ccl4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Ccl4; Mip1b; Scya4; C-C motif chemokine 4; Immune activation protein 2; ACT-2; ACT2; Macrophage inflammatory protein 1-beta; MIP-1-beta; Protein H400; SIS-gamma; Small-inducible cytokine A4
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
24-92aa
Target Protein Sequence
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In e.coli cells, the generation of recombinant Mouse Ccl4 protein involves cloning a DNA fragment encoding the Mouse Ccl4 protein (24-92aa) into a plasmid vector, which is then transferred into the e.coli cells. Positive cells are selected, cultured, and induced to express the Ccl4 protein. A N-terminal 6xHis tag is attached to the protein. Lysis of the cells allows for the harvest of the recombinant Mouse Ccl4 protein. The collected recombiant Mouse Ccl4 protein is subjected to affinity purification and is identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. Its purity is greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Monokine with inflammatory and chemokinetic properties.
Gene References into Functions
  1. CCL4-CCR5 axis can contribute to breast cancer metastasis to bone by mediating the interaction between cancer cells and fibroblasts in bone cavity. PMID: 27177471
  2. YY1 regulates lung CCL4 transcription in pulmonary tuberculosis. PMID: 26786659
  3. Ccl4 mRNAs increased within 5 h after injury in mouse cortical slices. PMID: 25895671
  4. CCL4 and CCL5 expression was higher in livers of infected WSX-1(-/-) mice than infected WT mice, and hepatic CD4 T cells from WSX-1(-/-) mice expressed higher levels of CCR5 than cells from WT mice PMID: 24244314
  5. CCL4 upregulation was associated with increased Snail expression and downregulation of p53/PTEN in high-grade PIN and prostate cancer PMID: 23878190
  6. These results suggest that MIP-1beta is a novel key mediator, and the peripheral MIP-1beta-CCR5 axis contributes to neuropathic pain. PMID: 22528550
  7. results indicate that MIP-1beta is involved in the recruitment of bone marrow-derived monocyte lineage cells PMID: 21912378
  8. increased responsiveness of murine eosinophils to MIP-1beta is mediated by CCR5 receptor in mice PMID: 12050188
  9. macrophage inflammatory protein-1beta is a hypoxia-induced neutrophil survival factor. PMID: 15630139
  10. MIP-1beta is overexpressed, and VE-cadherin is underexpressed in heart transplant allografts compared with isografts PMID: 15897346
  11. Overproduction of MIP-1beta in chemokine (C-C motif) receptor 5-deficient mice after collagen II-immunization may contribute partially to the occurrence of arthritis PMID: 15967376
  12. The expression and role CXCL12 and CCL4 and their receptors (CXCR4 and CCR5) in regulating thymocyte migration in conjunction with extracellular matrix during acute T. cruzi infection are investigated. PMID: 16637021
  13. ATF3 appears to be part of a control mechanism that limits the amount of CCL4 released by macrophages, preventing excessive inflammation. PMID: 16982098
  14. Antibody neutralization of CCL4 abrogates the ability of T-cells from IL-4-treated NOD mice to transfer protection against type 1 diabetes. PMID: 17327452

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*