Recombinant Mouse C-C motif chemokine 7 (Ccl7), partial

Code CSB-RP090994m
Abbreviation Recombinant Mouse Ccl7 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ccl7; Fic; Mcp3; Scya7C-C motif chemokine 7; Intercrine/chemokine MARC; Monocyte chemoattractant protein 3; Monocyte chemotactic protein 3; MCP-3; Protein FIC; Small-inducible cytokine A7
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
28-97aa
Target Protein Sequence
PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity.
Gene References into Functions
  1. The suppression of nasal inflammation due of IL-17A deficiency in allergic rhinitis is partly responsible for the regulation of CCL7 secretion and eosinophil infiltration, which may be regulated via the CCL7/CCR3 pathway. PMID: 28046055
  2. Our results demonstrate that CCL7 is required for maximal ovalbumin-induced ocular anaphylaxis, mast cell recruitment in vivo, and maximal FcepsilonRI-mediated mast cell activation in vitro PMID: 27956527
  3. Periprostatic adipocytes drive prostate cancer progression in obesity via CCL7 secretion which stimulates CCR3 expressing tumor cells. PMID: 26756352
  4. TFPI has an anti-proliferative role in TNF-alpha stimulated-VSMCs at least partly by interfering with the MCP-3/CCR2 pathway and then via suppression of the ERK1/2 and PI3K/AKT signaling pathways PMID: 26302185
  5. Our data highlight a pivotal role of CCL7 and IRF-7 in rhinovirus-induced inflammation PMID: 25847975
  6. CCL7 has a dual role in the development of renal tubular interstitial fibrosis, deleterious in early stages but beneficial during later stages PMID: 23872063
  7. These findings suggest that aortic MCP-3 overexpression may contribute to the development of atherosclerosis and hepatic steatosis under atherogenic conditions. PMID: 23462015
  8. An increase in the expression of MCP-3 along with IL-6 histone modification at the MCP-3 promoter promotes pain sensation associated with enhanced interaction between astrocytes and microglia in the spinal cord PMID: 23364351
  9. Electrical stimulation for 1 h significantly upregulates SDF-1 and MCP-3 expression that persists for 24 hours. PMID: 22006493
  10. Direct anal sphincter injury results in higher levels of SDF-1 and MCP-3 expression soon after injury, whereas denervation via pudendal nerve crush results in greater SDF-1 and MCP-3 expression 10 days after injury. PMID: 21706136
  11. Matrix metalloproteinase-2-mediated chemokine cleavage of MCP3 has an important role in cardiac inflammation as a negative feedback mechanism. PMID: 21986287
  12. expression of the chemokine, stromal cell-derived factor-1 (SDF-1) or monocyte chemotactic protein-3 (MCP-3) may enhance homing of osteogenic cells into sites of fracture repair PMID: 21567452
  13. CCL7 proteins were present in the vast majority of tissues investigated. mRNA for these proteins was also expressed in most of these tissues suggesting local production and the ability to respond in situ to inflammatory stimuli. PMID: 20931267
  14. MCP-3 is significantly over-expressed in the urethral tissues of both wild-type and obese mice immediately after any urethral manipulation. Underlying obesity resulted in alterations in response to tissue injury, paralleling the degree of injury. PMID: 20970834
  15. Monocyte chemoattractant protein-3 plays a critical role in mediating oxidative stress-induced neutrophilic airway inflammation and may have relevance in induction of neutrophilia in severe asthma. PMID: 11777981
  16. in study of relevance of chemokine expression to selective migration of t-cells and the disease localization in murine graft-versus-host disease, mcp3 was found to be predominantly expressed in skin and heart, and not spleen and liver. PMID: 12098066
  17. overexpression of MCP-3 in tight-skin mouse skin suggests a novel role for this protein as a fibrotic mediator activating extracellular matrix gene expression in addition to promoting leukocyte trafficking. PMID: 12847692
  18. These results indicate that CCR7-mediated cortex-to-medulla migration of thymocytes is essential for establishing central tolerance rather than for supporting the maturation or export of thymocytes. PMID: 16473829
  19. a novel mechanism for the recruitment of CCR10-positive T cells to skin-draining LN following the rapid release of preformed CCL27 from the epidermis. PMID: 18453562
  20. Cross-talk between MCP-3 and TGFbeta may be critical in the development of fibrosis. PMID: 19038247
  21. Up-regulated MCP-3 production does not compensate for loss of MCP-1; MCP-3 appears to be a less effective mediator of monocyte recruitment than MCP-1. PMID: 19641140

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*