Recombinant Mouse CD82 antigen (Cd82), partial

Code CSB-EP004961MO
Abbreviation Recombinant Mouse Cd82 protein, partial
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Cd82; Kai1CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1 homolog; CD antigen CD82
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
111-227aa
Target Protein Sequence
DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.5kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Gene References into Functions
  1. The CD82 is a functional surface marker of long-term repopulating hematopoietic stem cells (LT-HSCs) that maintains quiescence through interaction with DARC-expressing macrophages in the bone marrow stem cell niche. PMID: 26996598
  2. Loss of Kai1 expression is associated with neoplasm metastasis. PMID: 23401136
  3. The synergistic effects of CD82 and GM3 or GM2/GM3 ganglioside on EGFR expression and phosphorylation and cMet activation are responsible for CD82 inhibition of EGF- and HGF-dependent cell motility and migration of Hepa1-6 cells. PMID: 23968914
  4. the CD82 tetraspanin is specifically recruited to pathogen-containing phagosomes prior to fusion with lysosomes. PMID: 21149584
  5. KAI1 has a role in promotion of cell proliferation and mammary gland hyperplasia by the gp78 ubiquitin ligase PMID: 20089858
  6. Hypoxia-dependent induction of KAI1 was directly mediated by hypoxia-inducible factor-1alpha binding on the promoter, which subsequently caused increased recruitment of RNA polymerase II for transcriptional activation. PMID: 20123085
  7. An antibody to this protein that can specifically detect murine Kai1/CD82, should be useful in addressing the mechanism of action of Kai1 in metastatic suppression. PMID: 16372335
  8. gp78 promotes sarcoma metastasis by targeting KAI1 for degradation PMID: 18037895
  9. The transgenic adenocarcinoma of mouse prostate model encompasses androgen depletion independent sublines with increased tumorigenicity and invasiveness. All showed downregulation in tumor suppressor, E-cadherin, and metastatis suppressor, KAI-1. PMID: 18247402

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*