Recombinant Mouse Cardiotrophin-1 (Ctf1)

Code CSB-MP733705MO
Abbreviation Recombinant Mouse Ctf1 protein
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
CT-1;Ctf1
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-203aa
Target Protein Sequence
MSQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.8 kDa
Protein Length
Full Length
Tag Info
N-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
Gene References into Functions
  1. These results suggest that CT-1 may be a potent candidate for the early prevention and treatment of Alzheimer disease. PMID: 28731433
  2. Identify cardiotrophin-1 as a powerful cytokine promoting mesenchymal stromal cell engraftment and thus improving cell therapy of the infarcted myocardium. PMID: 28754835
  3. CT-1 mRNA levels in adipose tissue showed significant circadian fluctuations in young WT mice. Clock genes displayed a circadian rhythm in adipose tissue of both wild-type (WT) and CT-1-/- mice. However, the pattern was altered in CT-1-/- mice toward a lower percentage of the rhythm or lower amplitude, especially for Bmal1 and Clock. PMID: 28096235
  4. Cardiotrophin-1 modulates the production of adipokines in vitro and in vivo, suggesting that the regulation of the secretory function of adipocytes could be involved in the metabolic actions of this cytokine. PMID: 27608275
  5. Nuclear translocation of CT-1 regulates cardiomyogenesis of ES cells and involves calcium, NO, ROS as well as CT-1 regulated signaling pathways. PMID: 26005169
  6. Data suggest that Ctf1 up-regulates lipolysis in white adipocytes via 1) induction of perilipin, 2) activation of hormone sensitive lipase (via phosphorylation by PKA), and 3) inactivation of adipose triglyceride lipase (via up-regulation of G0S2). PMID: 25351614
  7. Cardiotrophin-1 (CT-1) is a hepatoprotective cytokine that modulates fat and glucose metabolism. Here we analyzed the changes in hepatic fat stores induced by recombinant CT-1 and its therapeutic potential in non-alcoholic fatty liver disease. PMID: 24362075
  8. The transgenic expression of CTF1 brought about a marked improvement on cognitive functioning in the APPswe/PS1dE9 transgenic mouse model of Alzheimer's disease. PMID: 23541490
  9. CT-1 improves beta cell function and survival, and protects mice against STZ-induced diabetes PMID: 23358882
  10. CT-1 may be a major regulator of arterial stiffness with a major impact on the aging process. PMID: 23172930
  11. Hypoxia increased cardiotrophin-1 levels in cardiac cells through a direct regulation of CT-1 promoter by HIF-1alpha, protecting cells from apoptosis. PMID: 21771897
  12. Data suggest a key role for CT-1 in cardiac remodeling induced by aldosterone independent of changes in blood pressure levels. PMID: 21926338
  13. We conclude that CT-1 is a master regulator of fat and glucose metabolism with potential applications for treatment of obesity and insulin resistance. PMID: 21803294
  14. Treatment of embryoid bodies grown from pluripotent murine embryonic stem (ES) cells with cardiotrophin 1 significantly stimulated cardiomyogenesis and increased nuclear expression of the proliferation marker Ki-67. PMID: 15023522
  15. The embryonic neurons of mice regulate the onset of cortical gliogenesis via cardiotrophin-1. PMID: 16242406
  16. In embryonic deficient mice, preganglionic sympathetic neurons were reduced. PMID: 16467531
  17. Induction of interleukin-6 mRNA after infarct was significantly abrogated in CT-1 null mice compared to wild-type mice PMID: 17150369
  18. CT-1 is an essential endogenous defense of the liver against ischemia-reperfusion injury and is a key mediator of the protective effect induced by ischemic preconditioning. PMID: 17178916
  19. Our data show that CT-1 is a natural defense of the liver against apoptosis. This cytokine may have therapeutic potential. PMID: 17326158
  20. adipose tissue can be recognized as a source of CT-1, which could account for the high circulating levels of CT-1 in patients with metabolic syndrome X PMID: 17940213
  21. aldosterone induces CT-1 expression in adult HL-1 cardiomyocytes via genomic and nongenomic mechanisms PMID: 18566129
  22. Cardiotrophin-1 is an osteoclast-derived stimulus of bone formation required for normal bone remodeling PMID: 18665789

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-6 superfamily
Tissue Specificity
Highly expressed in heart, skeletal muscle, liver, lung and kidney. Lower levels in testis and brain. No expression in spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*