Recombinant Mouse Cell surface glycoprotein CD200 receptor 1 (Cd200r1), partial, Biotinylated

In Stock
Code CSB-EP863669MO-B
Abbreviation Recombinant Mouse Cd200r1 protein, partial, Biotinylated
MSDS
Size $472
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
CD200 cell surface glycoprotein receptor;Cell surface glycoprotein OX2 receptor 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
26-238aa
Target Protein Sequence
TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
73.5 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitory receptor for the CD200/OX2 cell surface glycoprotein. Limits inflammation by inhibiting the expression of proinflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli.
Gene References into Functions
  1. In adoptive therapy of disseminated leukemia, CD200R-CD28-transduced leukemia-specific CD8 T cells eradicated otherwise lethal disease more efficiently than wild-type cells and bypassed the requirement for interleukin-2 administration to sustain in vivo activity. PMID: 29042364
  2. we revealed a critical role for CD200R signaling in limiting the growth and metastasis of CD200(+) tumors. PMID: 27385779
  3. CD200R signaling inhibits pro-angiogenic gene expression by macrophages and suppresses choroidal neovascularization. PMID: 24170042
  4. Data show that neutrophil infiltration of tissues was markedly decreased in CD200 antigen (tg) transgenic animals and increased in CD200 receptor 1 CD200R1(-/-) knockout mice. PMID: 25263452
  5. we show a causal role for the CD200-CD200R inhibitory axis in arteriogenesis in a murine hindlimb ischemia model. PMID: 24897500
  6. CD200-CD200R1 interaction in glial cells is involved in the neuroprotective action of PPAR-gamma agonists. PMID: 24639050
  7. [review] Influenza-infected CD200R1-deficient mice show less bacterial load and exhibit decreased pathogenesis and mortality than wild-type animals following streptococcal pneumonia superinfection. PMID: 24388216
  8. AML1-ETO upregulated CD200R1 in lineage(-) cells, which was characteristic of AML1-ETO-positive leukemia in mice. PMID: 23097187
  9. a role for both graft and host CD200/CD200R expression in increased allograft survival. PMID: 23178470
  10. The main sites of CD200/CD200 receptor (CD200R) interaction in neonates and blood vessels, until adulthood, highlight the possible role of the CD200/CD200R system in microglial development and renewal. PMID: 22323214
  11. CD200R1 does not play an essential role in macrophage homeostasis in the colon. PMID: 22204814
  12. study reports lack of CD200R signaling has a more profound effect on the beneficial but also on the pathological immune responses to viruses in female mice compared to male mice, which can be attributed to the capacity of CD200R to inhibit TLR7 responses PMID: 22615569
  13. It was demonstrated for the first time that the absence of CD200R signaling inhibits outgrowth of an endogenous skin tumor irrespective of CD200 expression by the tumor cells. PMID: 22020332
  14. these results indicate a role of CD200R:CD200 in T cell responses to helminths which has diagnostic and prognostic relevance as a marker of infection for chronic schistosomiasis in mouse and man. PMID: 22496920
  15. Data show thatthat the CD200R1/CD200 pathway is up-regulated in arthritis and plays a significant physiological role in regulating the severity of disease. PMID: 20735439
  16. The CD200 receptor gene family resembles the signal regulatory proteins and killer Ig-related receptors in having receptor family members with potential activatory and inhibitory functions that may play important roles in immune regulation and balance. PMID: 12960329
  17. Murine dendritic cells (DCs) possess a functional CD200R, whose engagement results in the reinforcement or appearance of immunosuppressive properties in these cells. PMID: 15356121
  18. Engagement of CD200R by agonist antibodies or ligand results in a potent inhibition of mast cell degranulation and cytokine secretion responses. PMID: 15661892
  19. Addition to bone-marrow cultures led to generation of dendritic cells that induced a CD4+CD25+) population inhibiting mixed leukocyte culture. PMID: 15880066
  20. results suggest that CD 200:CD 200 R interactions may play a role in regulating both Langerhans cells and dendritic epidermal T cells in cutaneous immune reactions PMID: 16354182
  21. increased endogenous expression of CD200 on osteoblast precursors, or addition of CD200Fc into cultures, led to increased osteoprotogerin PMID: 16530849
  22. CD200:CD200R1 plays an immunoregulatory role in vivo. PMID: 17667818
  23. Interaction between CD200 and its receptor plays a role in modulating microglial activation under conditions of chronic and acute inflammation of the brain. PMID: 17670977
  24. Mice lacking the ligand for CD200R, CD200-/- mice, do not show abnormal composition of the lymphocyte compartment and have normal B cell responses to antigenic challenge. PMID: 17714785
  25. CD200-CD200R axis is therefore a putative regulator of bone mass, via the formation of osteoclasts PMID: 17726108
  26. CD200(-/-) mice exhibit normal myelopoiesis and that development of leukaemia in Dok-1/Dok-2 DKO mice is not caused by a lack of CD200-mediated CD200R signalling. PMID: 17803680
  27. CD200R3 functions as an activating receptor on mast cells and basophils to regulate IgE-independent immune responses in cooperation with an inhibitory receptor CD200R PMID: 17982101
  28. The CD200-CD200R pathway seems of critical relevance for macrophage-mediated damage in autoimmune inflammation of the CNS. PMID: 18164423
  29. LPS-induced changes in CD200-CD200R equilibrium might keep microglia chronically activated. PMID: 19656578

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
CD200R family
Tissue Specificity
Expressed in granulocytes, monocytes, most T-cells and a subset of NK, NKT and B-cells (at protein level). Expressed in the spleen, lung, liver, testis, bone marrow, lymph nodes, spinal cord, kidney, uterus and small intestine. Expressed in mast and dendr
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*