Recombinant Mouse Cystathionine beta-synthase (Cbs)

Code CSB-YP849665MO
Abbreviation Recombinant Mouse Cbs protein
MSDS
Size US$368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Cbs; Cystathionine beta-synthase; EC 4.2.1.22; Beta-thionase; Serine sulfhydrase
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
2-561aa
Target Protein Sequence
PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
63.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
Gene References into Functions
  1. Data suggest that impaired cystathionine beta-synthase-hydrogen sulfide axis may contribute to the pathogenesis of Parkinson's disease, and that modulation of this axis may become a novel therapeutic approach for Parkinson's disease. PMID: 28774789
  2. results suggested that reduced cystathionine beta-synthase/hydrogen sulfide AMP-activated protein kinase (CBS-H2S-AMPK) cascade activity contributed to microglia-mediated neuroinflammation following stroke. PMID: 28751019
  3. Results indicate that activation of the cystathionine-beta-synthase (CBS) and its product hydrogen sulfide (CBS/H2S axis promotes colon carcinogenesis. PMID: 28923859
  4. showed that N-homocysteinylation of collagen in Cbs(-/-) mice impairs its cross-linking PMID: 27530978
  5. the findings of this study indicate that a deficiency in 3MST does not significantly affect endotoxemia, while a deficiency in CBS or CSE slightly ameliorates the outcome of LPS-induced endotoxemia in vivo. PMID: 27748832
  6. These data confirm a key role for the H2S-generating enzymes Cbs and Cth in pulmonary vascular development and homeostasis and in lung alveolarization. PMID: 26232299
  7. genetic deficiency results in reduced Tet1 and Tet2 expression, which leads to hypermethylation of Foxp3, and impairment of Treg cell differentiation and immune homeostasis. PMID: 26275994
  8. Elevated homocytsteine levels in the CBS-/+ mouse skeletal muscles caused diminished anti-oxidant capacity and contributed to enhanced total protein as well as PGC-1alpha specific nitrotyrosylation after ischemia. PMID: 25608649
  9. CBS disruption causes embryo retention and developmental delay in the mouse oviduct. PMID: 24914509
  10. CBS is present in adrenocortical cells and accounts for H2S generation in adrenal glands. CBS is critical for maintenance of mitochondrial function and glucocorticoid production in adrenal cortex. PMID: 24702258
  11. Elevating endogenous H2S via CBS over-expression in immortalized microglia not only reduced the expression of pro-inflammatory M1 genes, but also enhanced the anti-inflammatory M2 marker IL-10 production. PMID: 25086357
  12. Cbs protein expression is upregulated in brain cortex following traumatic brain injury. PMID: 23315129
  13. Brain of mice heterozygous for Cbs displays overexpression of DYR kinase and SAH hydrolase. PMID: 22700376
  14. These findings set the stage to investigate the role of CBS and the transsulfuration pathway in the generation of GSH in mouse retina. PMID: 23470016
  15. Hydrogen sulfide in the cortex and hippocampus exhibited dynamic changes after brain injury, in parallel with CBS mRNA and protein expression PMID: 23325453
  16. Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine beta-synthase: a target for neuronal antioxidant defense. PMID: 22891245
  17. Cystathionine beta-synthase deficiency causes infertility by impairing decidualization and gene expression networks in uterus implantation sites. PMID: 22617046
  18. Severe hyperhomocysteinemia promotes bone marrow-derived and resident inflammatory monocyte differentiation and atherosclerosis in LDLr/CBS-deficient mice. PMID: 22628578
  19. A survey of hemostatic and hemodynamic parameters revealed no detectible differences between control and Tg-I278T Cbs(-/-) mice. PMID: 22186991
  20. Results show that lack of CBS activity causes loss of fat mass, and that this effect appears to be independent of low serum tCys PMID: 22096601
  21. cbs is a primary 1,25-dihydroxyvitamin D(3)[1,25(OH)(2) D(3)- target gene which renders homocyeteine metabolism responsive to 1,25(OH)(2) D(3). PMID: 21898591
  22. Hyperhomocysteinemia impaired nitric oxide and endothelium-derived hyperpolarizing factor (EDHF) - mediated, endothelium-dependent relaxations of small mesenteric arteries in transgenic cystathionine beta synthase-deficient mice.[EDHF] PMID: 21653942
  23. cystathionine beta-synthase activity partially regulates endogenous H(2)S PMID: 20955694
  24. CBS expression is under dietary control; CBS is down-regulated within a few days upon initiation of methionine-deficient diet; such regulation is post-transcriptional in nature. PMID: 20036517
  25. The effects of CBS AND CSE gene transfer on the homocysteine-mediated inflmmation of mesangial cells induced by hydrogen sulfide and MCP-1 and MIP-2 induction are reported. PMID: 20943958
  26. We report here the generation of a new mouse model of classical homocystinuria in which the mouse cbs gene is inactivated and that exhibits low-level expression of the human CBS transgene under the control of the human CBS promoter PMID: 20638879
  27. birth incidence of cbs (-/-) mice produced from heterozygous crosses is non-Mendelian and not significantly improved by treatment with either the Hcy lowering compound betaine or the cysteine donor N-acetylcysteine. PMID: 20638882
  28. Cysteinemia, rather than homocysteinemia, is associated with plasma apolipoprotein A-I levels in hyperhomocysteinemia: lipid metabolism in cystathionine beta-synthase deficiency. PMID: 20537649
  29. cystathionine beta-synthase has a role in hepatic steatosis through abnormal lipid metabolism PMID: 15466479
  30. active CBS is essential for the formation of cysteinylated plasma albumin (CysAlb) PMID: 15555590
  31. hyperhomocysteinemia in liver of CBS-deficient mice promotes oxidative stress, which may cause mitochondrial damage in association with activation of hepatic stellate cells, leading to liver injury PMID: 15887121
  32. cystathionine beta-synthase plays a crucial role in the development and maintenance of the central nervous system PMID: 16160063
  33. Caerulein decreased the level of cystathionine beta-Synthase. PMID: 17488480
  34. Role of myofibroblasts differentiation in case of lung fibrosis due to CBS deficiency in mice. PMID: 17543941
  35. Cystathionine beta synthase secreted by granulosa cells is necessary for oocyte maturation. PMID: 17561372
  36. There was good CBS activity in the liver and cerebellum of the mouse but no activity in the retina. PMID: 17853447
  37. Transfection of endothelial cells with CBS gene construct reduced homocysteine accumulation in high methionine-fed cells. PMID: 17855772
  38. Cystathionine beta-synthase played essential roles in the central nervous system function and cysteine biosynthesis. PMID: 18364386
  39. Double heterozygous mice lacking one allele of Cbs and Apoa1 develop hyperhomocysteinemia and hypoalphalipoproteinemia together with moderate hypertension. PMID: 18508577
  40. cystathionine beta synthase deficiency initiates redox disequilibrium in the liver PMID: 18541157
  41. The effects of different degrees of Cbs deficiency on hyperhomocysteinemia symptoms are reported. PMID: 18987302
  42. Left ventricular hypertrophy was exaggerated in double knockout, and mildly increased in the CBS-/+, compared to WT mice PMID: 19021146
  43. Results collected from metabolome analyses suggested that CBS serves as a CO-sensitive modulator of H(2)S to support biliary excretion. PMID: 19085910
  44. hyperhomocysteinemia promotes differentiation of inflammatory monocyte subsets and their accumulation in atherosclerotic lesions via NAD(P)H oxidase-mediated oxidant stress in CBS deficiency PMID: 19858416

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cysteine synthase/cystathionine beta-synthase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*