Recombinant Mouse Dedicator of cytokinesis protein 2 (Dock2), partial

In Stock
Code CSB-EP806486MO
Abbreviation Recombinant Mouse Dock2 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Protein Hch
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1210-1621aa
Target Protein Sequence
YKDNNREEMYIRYLYKLRDLHLDCENYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLTQQAKFYENIMKILRTKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLLSQFPNAEKMNTTSAPGDDVRNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQKFHYSRPVRRGKVDPENEFASMWIERTSFLTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTVNEKILMMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYSREHPEDQDKLSHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.9 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in cytoskeletal rearrangements required for lymphocyte migration in response of chemokines. Activates RAC1 and RAC2, but not CDC42, by functioning as a guanine nucleotide exchange factor (GEF), which exchanges bound GDP for free GTP. May also participate in IL2 transcriptional activation via the activation of RAC2.
Gene References into Functions
  1. DOCK2 deficiency protects mice from HFD-induced obesity PMID: 28716822
  2. findings showed that DOCK2-driven T cell motility was required to detach from pMHC(low) dendritic cells (DCs)and to find rare presenting peptide-MHCs (pMHCs)(high) DCs. PMID: 28607113
  3. DOCK2 is a potential therapeutic target for novel AML treatments, as this protein regulates the survival of leukemia cells with elevated FLT3 activity and sensitizes FLT3/ITD leukemic cells to conventional antileukemic agents. PMID: 27748370
  4. Identify DOCK2 as a novel regulator for smooth muscle cell phenotypic modulation and vascular lesion formation after vascular injury. PMID: 25788409
  5. DOCK2 is critical for graft facilitating cells to maintain its immunomodulatory function. PMID: 25044556
  6. together with DOCK5 contributes to chemotaxis, reactive oxygen species production, and extracellular trap formation PMID: 25339677
  7. the IRF5 (-/-) mice with the DOCK2 mutation have higher serum levels of IgG1 and lower levels of IgG2b, IgG2a/c and IgG3 than IRF5 (-/-) mice without the DOCK2 mutation, suggesting that the DOCK2 mutation confers additional Th2-type effects. PMID: 23291967
  8. findings reveal a previously unknown, nonredundant role for Elmo1 in controlling Dock2 levels and Dock2-dependent T cell migration in primary lymphocytes. PMID: 24821968
  9. DOCK2, an atypical guanine nucleotide exchange factor for Rac, plays a key role in NK cell-mediated cytotoxicity. PMID: 23719299
  10. in vivo results presented here suggest DOCK2 contributes to amyloid beta plaque burden via regulation of microglial innate immune function and may represent a novel therapeutic target for Alzheimer's disease PMID: 23318649
  11. Results thus indicate that DOCK2 dimerization is functionally important under the physiological condition where only limited amounts of DOCK2 and Rac are localized to the plasma membrane. PMID: 23050005
  12. A spontaneous genomic duplication and frameshift mutation in the guanine exchange factor dedicator of cytokinesis 2 (Dock2) that has arisen in at least a subset of circulating Irf5(-/-) mice and inadvertently been bred to homozygosity. PMID: 22431588
  13. ASC shapes adaptive immunity independently of inflammasomes by modulating Dock2-dependent Rac activation and actin polymerization in DCs and lymphocytes. PMID: 21892172
  14. In plasmacytoid dendritic cells, the DOCK2-Rac signaling pathway acts in parallel with TLR engagement to control IKK-alpha activation for type I IFN induction. PMID: 20231379
  15. A review article on the role of DOCK2 in lymphocyte migration. PMID: 12191913
  16. plays a role in lymphocyte migration via Rac activation in the cytoskeleton PMID: 12518436
  17. DOCK2 regulates T cell responsiveness through remodeling of actin cytoskeleton via Rac activation. PMID: 12871644
  18. Deletion of DOCK2, a regulator of the actin cytoskeleton in lymphocytes, suppresses cardiac allograft rejection. PMID: 16230477
  19. DOCK2 deficiency causes marked reduction of Valpha14 NKT cells in the thymus, liver, and spleen. PMID: 16585555
  20. DOCK2 has a role in regulating chemokine-triggered lateral lymphocyte motility but not transendothelial migration PMID: 16772603
  21. Within peripheral lymph nodes, T and B cells require DOCK2 for extensive screening of their respective microenvironments; a central role is shown for DOCK2 during sphingosine-1-phosphate-triggered lymphocyte signaling. PMID: 17325199
  22. Dock2 links T cell receptor signals to downregulation of IL-4Ralpha to control the lineage commitment of CD4+ T cells. PMID: 17767160
  23. In DOCK2(-/-) plasmacytoid dendritic cells, chemokine-induced Rac activation was severely impaired, resulting in the reduction of motility and the loss of polarity during chemotaxis PMID: 18198348
  24. PI3K and Src-ELMO-Dock2 pathways work in parallel to activate Rac2 and modulate chemotaxis in response to a CXCL8 gradient in neutrophils. PMID: 18662984
  25. findings show that intracellular DOCK2 dynamics are sequentially regulated by distinct phospholipids to localize Rac activation during neutrophil chemotaxis PMID: 19325080
  26. deficiency in DOCK2 significantly impaired CCL21-mediated costimulation in TCR-tg CD4(+) T cells, concomitant with impaired Rac- but not Ras-GTP formation PMID: 19451552
  27. Results indicate that the combination of DOCK2 and DOCK180 plays a significant but not essential role in prevascular fetal thymus colonization. PMID: 19728314
  28. DOCK2 regulates microglial innate immunity independent of COX2 induction and DOCK2+ microglia are associated with human Alzheimer's disease pathology. PMID: 19729484
  29. haematopoietic cell-specific CDM protein family member is indispensable for lymphocyte chemotaxis PMID: 11518968

Show More

Hide All

Subcellular Location
Endomembrane system; Peripheral membrane protein. Cytoplasm, cytoskeleton.
Protein Families
DOCK family
Tissue Specificity
Specifically expressed in hematopoietic cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*