Recombinant Mouse Erythropoietin receptor (Epor), partial

In Stock
Code CSB-MP007744MO1
Abbreviation Recombinant Mouse Epor protein, partial
MSDS
Size $318
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
EPO-R
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
25-249aa
Target Protein Sequence
APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.5 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.
Gene References into Functions
  1. these results have revealed that phosphorylation of Tyr-343, Tyr-460, and Tyr-464 in EpoR underlies JAK2 V617F mutant-induced tumorigenesis. PMID: 27998978
  2. A solution NMR study of the mouse erythropoietin receptor (mEpoR) comprising the transmembrane domain and the juxtamembrane regions reconstituted in dodecylphosphocholine (DPC) micelles. PMID: 26316120
  3. loss of function results in defective macrophage clearance of apoptotic cells in vivo PMID: 26872696
  4. These data indicate that EpoR signaling is associated with cardiac remodeling following chronic iron deficiency. PMID: 25715089
  5. We propose that the CID-dependent dimerization system combined with the EpoR intracellular domain and the Gata1 gene regulatory region generates a novel peroral strategy for the treatment of anemia. PMID: 25790231
  6. transmembrane domain and the juxtamembrane region of the erythropoietin receptor in micelles PMID: 25418301
  7. EpoR and its activity are downstream effectors of Klotho enabling it to function as a cytoprotective protein against oxidative injury. PMID: 23636173
  8. Expression of EPOR in rod photoreceptors, Muller cells, and amacrine, horizontal, and ganglion cells of the peripheral retina is not required for the maturation, function, and survival of these cells in aging tissue. PMID: 24644405
  9. Data from knockout mice suggest that adipose tissue-specific disruption of EPO receptor does not alter adipose tissue expansion, adipocyte morphology, insulin resistance, inflammation, or angiogenesis. PMID: 23885016
  10. the EPO-EPOR system may play a role in glucose metabolism within adipocytes. PMID: 23313788
  11. EPOR regulates transcriptome for primary progenitors, including Tnfr-sf13c as a novel mediator of EPO-dependent erythroblast formation. PMID: 22808010
  12. expression of EPOR decreased with the development of renal cortex PMID: 22844537
  13. enhanced activation of signaling pathways downstream of the EPO-receptor, indicate that SH2B1 is a negative regulator of EPO signaling. PMID: 22669948
  14. EPO/EPOR signaling from astrocyte to oligodendrocyte progenitor cells (OPC) prevents OPC damage under hypoxic/reoxygenation conditions. PMID: 21833990
  15. Postmortem neural precursor cells differentiate mostly in self-renewable neurons, show activation, and express both erythropoietin (EPO) and its receptor (EPO-R). PMID: 21324364
  16. expressed in both non-wounded and wounded skin tissue as well as in fibroblasts and keratinocytes PMID: 21894148
  17. Gata4 or Sp1 may limit the accessibility of the EpoR for binding of erythropoiesis-stimulating agents. PMID: 21029371
  18. Mice with transgenic expression of a constitutively active erythropoietin receptor isoform in pyramidal neurons of cortex and hippocampus exhibit enhancement of spatial learning, cognitive flexibility, social memory, and attentional capacities. PMID: 21527022
  19. The Epo/EpoR complex plays a critical role in the adhesion and migration of rat fibroblasts, and its functional inactivation is associated with PLC-gammal-dependent reduction of cell-matrix adhesion and this also affects cell migration. PMID: 21360263
  20. genetic ablation promotes Salmonella elimination PMID: 21256055
  21. These data provide evidence of a role for nitric oxide in erythropoietin activity in brain and suggest links between NO production, EpoR expression, and Epo signaling in neuroprotection. PMID: 20806411
  22. The phosphorylation of EpoR at Y479 is required for oncogenic signaling of JAK2 V617F mutant and that targeted disruption of this pathway has therapeutic utility. PMID: 21255641
  23. ubiquitination of the EpoR critically controls both receptor down-regulation and downstream signaling. PMID: 21183685
  24. Darbepoetin stimulates multiple cardioprotective mechanisms in infarcted myocardium to improve cardiac function independent of erythropoietin receptor-common beta-chain heteroreceptor. PMID: 20649603
  25. regional specific up-regulation of EPOR at an early stage after MPTP stimulus may represent a pro-survival mechanism against neurotoxin injury in Parkinsonian model PMID: 19537929
  26. rapid ligand depletion & replenishment of cell surface receptor are characteristic of EpoR; Epo-EpoR complexes & EpoR activation integrated over time correspond linearly to ligand input; relation depends on EpoR turnover PMID: 20488988
  27. the presence of EpoR is required to activate oncogenic signaling via the JAK2 mutant and STAT5, its interacting ability is a target for the treatment of these hematopoietic diseases. PMID: 20028972
  28. N-terminal domain of Janus kinase 2 is required for Golgi processing and cell surface expression of erythropoietin receptor PMID: 11779507
  29. Epo receptor cytoplasmic domain conformation is essential for the initiation of signal transduction PMID: 11997394
  30. developmental defect of PrlR(-/-) mammary epithelium is rescued by an exogenously expressed chimeric receptor (prl-EpoR) containing the PrlR extracellular domain joined to the EpoR transmembrane and intracellular domains PMID: 12381781
  31. demonstration of an essential role for Src pathway in regulating growth, proliferation, and cooperation with Epo-Receptor downstream from Kit PMID: 12486028
  32. C-hexosylation of the WSAWS motif did not play a role in the correct intracellular transport of sEPOR PMID: 12859190
  33. the function of JAK2-coupled but phosphotyrosine-null Epo form appears to be attenuated in several contexts and to be assisted in vivo by compensatory mechanisms. PMID: 12869513
  34. the Epo receptor Tyr-343 Stat5 pathway has a role in proliferative co-signaling with kit PMID: 12909618
  35. EpoR can be activated to different extents by homodimeric gp55 proteins, depending on the conformation of the gp55 protein dimer in the TM region PMID: 12930840
  36. erythropoietin receptor transmembrane segments self-interaction depends on a membrane-spanning leucine zipper PMID: 14602718
  37. Data suggest that the activity of the erythropoietin receptor is determined by the helical periodicity or orientation of the transmembrane and cytosolic domains. PMID: 14636581
  38. results elucidate a previously unrecognized hematopoietic cell survival pathway elicited by the EPOR, that requires Stat5 and is serum independent. PMID: 14662339
  39. a functional EPO-R may be necessary and sufficient for TPO to exert its mitogenic effects on erythroid cells. PMID: 15102474
  40. Knockout mice exhibit normal erythrocyte maturation, so receptor is not resquired for erythropoiesis PMID: 15456912
  41. the TM-JM junction of EpoR forms an N-terminal helix cap required for function PMID: 15657048
  42. Friend virus activates both sf-STK and the EPOR to cause deregulated erythroid proliferation and differentiation. PMID: 16174761
  43. In knockout mice, epoietein induced reticulocyte and erythroblast maturation were attenuated. PMID: 16332976
  44. analysis of gene expression induced by erythropoietin receptor structural variants PMID: 16380376
  45. model of the active and inactive conformations of the Epo receptor PMID: 16414957
  46. The classical EPOR is essential for EPO action during embryonic neurogenes & is important for adult neurogenesis and for migration of regenerating neurons during post-injury recovery. PMID: 16436614
  47. Stress erythropoiesis during anemia is rescued to wild type levels upon the selective restoration of an EpoR-phosphotyrosine-Stat5-binding site signaling axis. PMID: 16511603
  48. The vascular EpoR system plays an important role in angiogenesis in response to hindlimb ischemia through upregulation of the vascular endothelial growth factor/VEGF receptor system. PMID: 17293480
  49. In mice expressing an EpoR allele, compromised erythropoietin-induced podocalyxin expression correlated with enucleated red cells in bone marrow. PMID: 17403918
  50. Hypoxic downregulation of sEpoR is required for adequate ventilatory acclimatization to hypoxia. PMID: 17584830

Show More

Hide All

Subcellular Location
[Isoform EPOR-F]: Cell membrane; Single-pass type I membrane protein.; [Isoform EPOR-S]: Secreted.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity
Expressed in relatively mature erythroid progenitor cells and in EPO-responsive erythroleukemia cells.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*