Recombinant Mouse Extracellular superoxide dismutase [Cu-Zn] (Sod3)

Code CSB-EP022399MO
Abbreviation Recombinant Mouse Sod3 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-251aa
Target Protein Sequence
SSFDLADRLDPVEKIDRLDLVEKIGDTHAKVLEIWMELGRRREVDAAEMHAICRVQPSATLPPDQPQITGLVLFRQLGPGSRLEAYFSLEGFPAEQNASNRAIHVHEFGDLSQGCDSTGPHYNPMEVPHPQHPGDFGNFVVRNGQLWRHRVGLTASLAGPHAILGRSVVVHAGEDDLGKGGNQASLQNGNAGRRLACCVVGTSSSAAWESQTKERKKRRRESECKTT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
Gene References into Functions
  1. Enhanced expression of EcSOD in skeletal muscle profoundly protects against multiple organ dysfunction syndrome by inhibiting endothelial activation and inflammatory cell adhesion. PMID: 28982599
  2. Epigenetic regulation of EC-SOD expression in aging lung fibroblasts is exerted via histone acetylation. PMID: 28757400
  3. Results indicate that medium molecular weight heparinyl phenylalanine (MHF) and medium molecular weight heparinyl leucine (MHL) show a radical scavenging ability by increasing the extracellular superoxide dismutase (EC-SOD) activity and MHF may be a candidate for clinical use. PMID: 27815470
  4. Thus, our findings suggest that deficient management of extracellular superoxide can lead to altered lung developmental signaling during alveogenesis in mice. PMID: 28220305
  5. the redistribution of SOD3 as a result of the R213G single-nucleotide polymorphism protects mice from bleomycin-induced fibrosis and secondary pulmonary hypertension by improved resolution of alveolar inflammation. PMID: 27805412
  6. These data reveal that ecSOD activity modulates neutrophil recruitment and function in a cell-extrinsic fashion, highlighting the importance of the enzyme in protecting tissues from oxidative damage. PMID: 27600509
  7. wound healing impairments in ageing are associated with increased levels of ROS, decreased SOD3 expression and impaired extracellular oxidative stress regulation PMID: 26663425
  8. FXR may regulate SOD3 expression to suppress reactive oxygen species production, resulting in decreasing JNK activity. PMID: 25496033
  9. Arginine 213 in the heparin-binding domain of SOD3 is critical for maintaining proper organ function through moderating the normal innate immune response, which would otherwise lead to chronic inflammation and degenerative diseases in aged mice. PMID: 25927599
  10. the rs1799895 polymorphism in extracellular superoxide dismutase affects cardiopulmonary disease risk by altering protein distribution PMID: 25085920
  11. the localized loss of pulmonary artery EC-SOD augments chronic hypoxic pulmonary hypertension. In addition to oxidative inactivation of nitric oxide, deletion of EC-SOD seems to reduce eNOS activity, further compromising pulmonary vascular function. PMID: 25326578
  12. Our results suggest that EC-SOD plays a dynamic role in the inflammatory response mounted by activated macrophages. PMID: 24512907
  13. reduced SOD3 expression correlates with alveolar injury measures in the recovered neonatal hyperoxic lung PMID: 24673633
  14. Data suggest that epigenetic silencing of EcSOD may contribute to mammary tumorigenesis and that restoring the extracellular superoxide scavenging activity could be an effective strategy for breast cancer treatment. PMID: 23318435
  15. When Cys195 was introduced, both active EC-SOD and a novel inactive EC-SOD were generated, and the specific activity of the EC-SOD was significantly reduced by the mutation. PMID: 23594119
  16. a decrease in ATP7A protein expression contributes to impaired SOD3 activity, resulting in O2(*-) overproduction and endothelial dysfunction in blood vessels of type 1 diabetes mellitus. PMID: 23884884
  17. Cardiac-selective expression of EcSOD from the cardiac troponin-T promoter after systemic administration of AAV9 provides significant protection against both acute myocardial infarction and left ventricular remodeling. PMID: 23536266
  18. EC-SOD plays a key role in preserving angiogenesis by scavenging free radicals which has an inhibitory effect on angiogenesis process in neonatal mice lung following exposure to hyperoxia. PMID: 23284826
  19. Data suggest that SOD3 is required to maintain lung homeostasis and acts, at least in part, as a controller of signaling and a decision maker to determine the progression of allergic lung disease. PMID: 22583151
  20. the SOD3-mediated anti-inflammatory effect on arthritis and peritonitis operates independently of NOX2 complex derived oxidative burst PMID: 22529530
  21. The SOD3 might provide an effective strategy for the treatment of HAF-mediated skin inflammation. PMID: 21957979
  22. High levels of ecSOD activity resulted in neutrophils with limited protective capacity, whereas neutrophils from mice lacking ecSOD provided superior protection compared with neutrophils from wild-type mice. PMID: 22393157
  23. physiological venous catalase activity prevents exercise-induced up-regulation of endothelial nitric oxide synthase and extracellular superoxide dismutase PMID: 21129156
  24. ER stress leads to the down-regulation of claudin-5 among tight junction proteins and may induce the elevation of endothelial permeability and leakage of EC-SOD into the vitreous body. PMID: 21736484
  25. AAV9-mediated overexpression of EcSOD in skeletal muscle significantly improves recovery from hind-limb ischemia in mice, consistent with improved capillary density and perfusion ratios in treated mice. PMID: 21723687
  26. A single direct injection into the left ventricular wall of an adeno-associated virus 9 (AAV9) vector expressing extracellular superoxide dismutase from the cardiac troponin-T promoter protects mice against myocardial infarction. PMID: 21674736
  27. Extracellular superoxide dismutase facilitates clearance of bacteria and limits inflammation in response to infection by promoting bacterial phagocytosis. PMID: 21641397
  28. These data suggest that the extracellular superoxide dismutase in vascular smooth muscle is not involved in the genesis of angiotensin II-induced hypertension and further emphasize the role of central SOD3 in the modulation of blood pressure. PMID: 21730294
  29. endogenous SOD3 has no role in the development of pulmonary artery hypertension under control conditions but plays an important role in protecting the lung from the development of PAH under stress conditions. PMID: 21730301
  30. The ecSOD as an important anti-inflammatory gene, responsible for most, if not all of the resistance to asbestos-induced lung injury reported for the 129/J strain of mice. PMID: 21362472
  31. Extracellular superoxide dismutase protects cardiovascular syndecan-1 from oxidative shedding and prevents from its subsequent induction of fibroblast proliferation. PMID: 21334435
  32. extracellular superoxide dismutase is expressed spatiotemporally in developing embryos and surrounding extraembryonic tissues during mouse organogenesis, thus suggesting that EC-SOD may be relevant to organogenesis PMID: 21156216
  33. extracellular H(2)O(2) generated by ecSOD localized at caveolae/lipid rafts via heparin-binding domain promotes VEGFR2 signaling via oxidative inactivation of PTPs in these microdomains. PMID: 20422004
  34. When cortices and hippocampi were analyzed for nitrotyrosine formation as an index of oxidative stress, the levels were chronically elevated in mice lacking extracellular superoxide dismutase PMID: 20020436
  35. role of SOD3 in recovery of renal blood flow, increased oxidative stress, and injury following renal ischemia/reperfusion PMID: 20505656
  36. Data show that SOD3 attenuates emphysema and reduces oxidative fragmentation of ECM in lung. PMID: 20713693
  37. EC-SOD accumulates on endothelial cells in response to brain ischemia by an unknown mechanism, while cortical neurons produce EC-SOD themselves after cerebral ischemia with reperfusion PMID: 11827754
  38. Furin proteolytically processes the heparin-binding region of extracellular superoxide dismutase PMID: 11861638
  39. EC-SOD plays an important role in reducing the magnitude of lung injury from extracellular free radicals after bleomycin administration. PMID: 11880297
  40. Data suggest that competition between Ets activators and Kruppel-like repressors within the proximal promoter region determines the level of extracellular superoxide dismutase expression in a particular cell type. PMID: 12374566
  41. Extracellular superoxide dismutase, uric acid, and atherosclerosis. Review. PMID: 12858574
  42. describes a previously unrecognized murine extracellular superoxide dismutase (ecSOD) allele and its effects on the ecSOD phenotype independent of other strain specific factors. Underlines need for backcrossing of genetically modified mice. PMID: 12893682
  43. Serum EC-SOD might accumulate on brain endothelial cells, while cortical neurons produce EC-SOD themselves after cerebral ischemia with reperfusion. PMID: 14753411
  44. Hypoxic activation of HIF-1 alpha and its target gene EPO in mouse kidney is regulated by SOD3. PMID: 15016652
  45. Review. Blood vessels express 3 isoforms of superoxide dismutase SOD, 1 of which is an extracellular form of CuZn-SOD. This review will focus mainly on the role of individual SODs in relation to endothelium under normal conditions and in disease states. PMID: 15166009
  46. EC-SOD functions as a major repressor of hypoxia-induced Epo gene expression, which implicates superoxide as a signaling intermediate whose downstream effects, at least in part, may be mediated by HIF-1alpha. PMID: 15375030
  47. EC-SOD's proximal promoter contains 2 previously unknown but putative Sp1 cis elements, the 2d of which contributes up to 70% of the constitutive EC-SOD promoter activity. Sp3 also binds to this region. PMID: 15451065
  48. EcSOD-fibulin-5 interaction is needed for ecSOD binding to vascular tissues, regulating their O2*- levels. This is a new mechanism for controlling vascular redox state in the extracellular space in cardiovascular diseases with high oxidative stress. PMID: 15528465
  49. Atox1 functions not only as a copper chaperone for SOD3 but also as a positive regulator for SOD3 transcription and may have an important role in modulating oxidative stress in the cardiovascular system. PMID: 15761197
  50. EC-SOD may play important role in protection from skeletal muscle ischemia and reperfusion injury caused by excessive generation of reactive oxygen species. PMID: 15778274

Show More

Hide All

Subcellular Location
Secreted, extracellular space. Golgi apparatus, trans-Golgi network.
Protein Families
Cu-Zn superoxide dismutase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*