Recombinant Mouse Ferritin heavy chain (Fth1)

Code CSB-EP009030MO
Abbreviation Recombinant Mouse Fth1 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ferritin H subunit
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-182aa
Target Protein Sequence
MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.
Gene References into Functions
  1. FtMt overexpressing mice have no significant defects and the overexpression of FtMt does not affect the regulation of iron metabolism significantly in transgenic mice. PMID: 28703745
  2. Ferritin is considered the major iron storage protein which maintains a large iron core in its cavity and has ferroxidase activity. (Review) PMID: 28349628
  3. the absence of Mitochondrial ferritin, which is highly expressed in the heart, increases the sensitivity of mitochondria to cardiac injury via oxidative stress. PMID: 27853170
  4. As previously reported, homozygous loss of the Fth allele on a wild-type Ftl background was embryonic lethal. expression of the H subunit can rescue the loss of the L subunit and that H ferritin homopolymers have the capacity to sequester iron in vivo PMID: 25629408
  5. provide a new mechanism for selective autophagy of ferritin and reveal a previously unappreciated role for autophagy and NCOA4 in the control of iron homeostasis in vivo PMID: 25327288
  6. Our data show that ferritin H is required for B and T cell survival by actively reducing the labile iron pool. PMID: 24586648
  7. Ferritin H deficiency in most cells of the forebrain including cells of the choroid plexus caused accumulation of cerebrospinal fluid in the lateral ventricles and the subarachnoid space PMID: 24662374
  8. Mycobacterium avium infection induces H-ferritin expression in mouse primary macrophages by activating Toll-like receptor 2. PMID: 24349383
  9. 3-Hydroxybutyrate dehydrogenase-2 and ferritin-H synergistically regulate intracellular iron. PMID: 24673886
  10. Fth plays a critical protective role during acute kidney injury. PMID: 24018561
  11. FtH provides metabolic adaptation to tissue Fe overload, conferring tolerance to malaria PMID: 23159058
  12. The delivery of iron to oligodendrocytes via H-ferritin is a biologically relevant delivery system, given that ferritin--not transferrin--receptors can be demonstrated on oligodendrocytes in vivo. PMID: 21446040
  13. HFt taken up by TIM-2 positive cells transited through the endosome and eventually entered a lysosomal compartment, distinguishing the HFt pathway from that of transferrin PMID: 21886823
  14. Mitochondrial ferritin is found in all regions of the brain in C57/BL6 mice; the role of mitochondrial ferritin can be expected to contribute to our knowledge of mitochondrial dysfunction and neurodegenerative disease. PMID: 20722075
  15. Loss of one allele of H ferritin appears to increase light-induced degeneration. PMID: 20881284
  16. Hx plays an important role in controlling iron distribution within brain, thus suggesting its involvement in iron-related neurodegenerative diseases. PMID: 19120692
  17. FTH expression is mediated by Nrf2 in response to xenobiotics and cancer chemopreventive dithiolethiones PMID: 12435735
  18. Ferritin heavy chain 1 necessary for tumor necrosis factor alpha-induced apoptosis in L929 cells. PMID: 16024802
  19. excessive free iron and the resultant enhanced oxidative stress caused by downregulation of FHC lead to cardiomyocyte death PMID: 18992754

Show More

Hide All

Protein Families
Ferritin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*