Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

In Stock
Code CSB-YP009434MO
Abbreviation Recombinant Mouse Gip protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Gip was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
GIP;Glucose-dependent insulinotropic polypeptide
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
44-85aa
Target Protein Sequence
YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.6 kDa
Protein Length
Partial
Tag Info
N-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
Gene References into Functions
  1. GIP stimulation induces a switch in GIPR recycling from a rapid endosomal to a slow trans-Golgi network (TGN) pathway. GPCR kinases and b-arrestin2 are required for this switch in recycling. PMID: 27974210
  2. GIP provides a novel link between the immune system and the gut, with proinflammatory-immune modulatory function but minor glucose regulatory relevance in the context of acute endotoxemia. PMID: 27350651
  3. our data suggest that the metabolic hormone GIP plays an important role in bone marrow hematopoiesis PMID: 28250160
  4. It was demonstrated that cardiomyocytes represent a direct target of GIP action in vitro, and that GIP ameliorated AngII-induced cardiac hypertrophy via suppression of cardiomyocyte enlargement, apoptosis, and fibrosis in vivo. PMID: 27375170
  5. The loss of food-induced GIP response in Roux-limb of intestine likely contributes to the attenuated serum GIP response to feeding. PMID: 26266950
  6. GIP induces the expression of the proatherogenic cytokine osteopontin (OPN) in mouse arteries via local release of endothelin-1 and activation of CREB. GIPR mRNA is higher in symptomatic carotid endarterectomy patients. PMID: 26395740
  7. These studies support the hypothesis that a reduction in GIP signaling using a GIP-neutralizing mAb might provide a useful method for the treatment and prevention of obesity and related disorders. PMID: 26487006
  8. This study provides evidences that GIP acts directly on osteoblasts and is capable of improving collagen maturity and fibril diameter. PMID: 25582623
  9. There was decrease in GIP gene transcripts and protein in the gut of HNF1a-null mice. PMID: 25979074
  10. Circulating levels of GIP were significantly decreased in FABP5-deficient mice. PMID: 25268051
  11. phosphatidylinositol 3-kinase gamma has a role in insulin secretion induced by glucose-dependent insulinotropic polypeptide PMID: 25288806
  12. The results describe key beneficial immunoregulatory properties for glucose-dependent insulinotropic polypeptide in diet-induced obesity and reveal that its augmentation ameliorates adipose tissue inflammation and improves insulin resistance. PMID: 25217161
  13. GIP-reduced mice demonstrate that partial reduction of GIP does not extensively alter glucose tolerance, but it alleviates obesity and lessens the degree of insulin resistance under high-fat diet conditions, suggesting a potential therapeutic value. PMID: 24584548
  14. It was concluded from these observations that GIP, but not glucagon-like peptide-1, directly activates PepT1 activity by a cAMP-dependent signaling pathway in jejunum. PMID: 24072682
  15. A novel acylated form of (d-Ala(2))GIP with improved antidiabetic potential, lacking effect on body fat stores. PMID: 23518200
  16. The results indicated that ectopic glucose-dependent insulinotropic polypeptide expression in pancreatic beta cells maintains insulin secretion in the absence of proglucagon-derived peptides, revealing a novel mechanism for sustaining incretin action. PMID: 23099862
  17. Rfx6 increases GIP expression and content in enteroendocrine K-cells and is involved in GIP hypersecretion in high fat diet-induced obesity. PMID: 23192339
  18. GIP signaling may play a role in early embryonic pancreas differentiation to form insulin-positive cells or beta-cells. PMID: 21270265
  19. truncated forms of GIP exhibit potent anti-diabetic actions, without pro-obesity effects, and that the C-terminus contributes to the lipogenic actions of GIP PMID: 20231880
  20. GIP is expressed in and secreted from pancreatic islets and promotes islet glucose competence and also could support islet development and/or survival. PMID: 20138041
  21. substantial quantities of glycated GIP exist within the intestines of diabetic ob/ob mice, suggesting that this may be a contributing factor to the physiological disarray of this syndrome PMID: 11954659
  22. a novel pathway of obesity promotion via GIP; GIP directly links overnutrition to obesity PMID: 12068290
  23. Novel insulin/GIP co-producing cell lines provide unexpected insights into Gut K-cell function in vivo. PMID: 12124779
  24. Calcium mobilization from intracellular and extracellular sources, independent from K(ATP) channels, regulates secretion from some, but not all, subpopulations of enteroendocrine cells. PMID: 12676650
  25. GIP is the major insulinotropic factor in the secretion of insulin in response to glucose load in K(ATP) channel-deficient mice. PMID: 15362972
  26. Transcription factor PDX-1 plays a critical role in the cell-specific expression of the GIP gene. PMID: 15486225
  27. The physiological importance of glucose-dependent insulinotropic polypeptide has been investigated in single and double incretin receptor knockout mice. PMID: 15780432
  28. PI3K/PKB/Foxo1 signaling mediates GIP suppression of bax gene expression, which is a key pathway by which GIP regulates beta-cell apoptosis in vivo PMID: 15817464
  29. GIP plays a crucial role in switching from fat oxidation to fat accumulation under the diminished insulin action as a potential target for secondary prevention of insulin resistance PMID: 16105663
  30. Because GIPR(-/-) mice exhibited an increased plasma calcium concentration after meal ingestion, GIP directly links calcium contained in meal to calcium deposition on bone. PMID: 16469773
  31. Prohormone convertase 1/3 is essential for processing of the glucose-dependent insulinotropic polypeptide precursor PMID: 16476726
  32. protein kinase B, LKB1, and AMP-activated protein kinase have roles in activation of lipoprotein lipase by glucose-dependent insulinotropic polypeptide in adipocytes PMID: 17244606
  33. Glucose-dependent insulinotropic peptide inhibits bone resorption and stimulates bone formation PMID: 17321229
  34. First characterization of the anatomical distribution of GIP-immunoreactive cells in the rat brain providing an anatomical framework for future investigations regarding the functions of GIP in the central nervous system. PMID: 17510976
  35. Administration of resistin to adipocytes mimicked the effects of GIP on the PKB/LKB1/AMPK/LPL pathway: increasing phosphorylation of PKB, reducing levels of phosphorylated LKB1 and AMPK, and increasing LPL activity. PMID: 17890220
  36. genetic inactivation of GIP signaling can prevent the development of aging-associated insulin resistance through body composition changes PMID: 17937928
  37. GATA-4 may function to augment or enhance GIP expression rather than act as an initiator of GIP transcription. PMID: 18343025
  38. Gpr40 modulates FFA-stimulated insulin secretion from beta-cells not only directly but also indirectly via regulation of incretin(GIP and GLP-1) secretion PMID: 18519800
  39. The GIP-induced increase in glucose transport appears to be mediated, at least in part, by SGLT-1. PMID: 18719661
  40. These results indicate that inhibition of GIP signaling increases adiponectin levels, resulting in increased fat oxidation in peripheral tissues under high-fat diet. PMID: 18723001

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glucagon family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*