Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Cd74; Ii; H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide; CLIP)]
Species
Mus musculus (Mouse)
Expression Region
56-279aa
Target Protein Sequence
QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 56-279 form the expressed segment for recombinant Mouse Cd74. The expected molecular weight for the Cd74 protein is calculated to be 29.4 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis tag was fused into the coding gene segment of Cd74, making it easier to detect and purify the Cd74 recombinant protein in the later stages of expression and purification.
The H-2 class II histocompatibility antigen gamma chain (CD74) is a protein that has been extensively studied across various research domains. In immunology, CD74 takes center stage in the field of antigen presentation. As a key player in the major histocompatibility complex class II (MHC-II) pathway, it plays a crucial role in presenting antigens to immune cells, facilitating the initiation of immune responses. In the context of inflammatory and autoimmune diseases, CD74 has emerged as a significant target for investigation. Its involvement in modulating immune responses makes it a potential candidate for therapeutic interventions aimed at regulating immune activity in conditions like rheumatoid arthritis and inflammatory bowel disease. Furthermore, CD74 has been implicated in cancer research. Its expression patterns and functions in tumor cells and the tumor microenvironment are of interest in understanding how cancer cells evade the immune system and promote tumor growth.