Recombinant Mouse Interleukin-11 (Il11)

Code CSB-EP011583MO
Abbreviation Recombinant Mouse Il11 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
IL-11
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
22-199aa
Target Protein Sequence
PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation, also in the context of various cancers. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'.
Gene References into Functions
  1. Consistent with these in vitro findings, IL-11 promoted HSC engraftment in a mouse model of AA, an effect that was attenuated in cells overexpressing miR-204-5p. The reduction in miR-204-5p levels is an integral component of IL-11 signaling that may play an essential role in treating aplastic anemia (AA). PMID: 29217821
  2. classic but not trans-signaling essential for fertility PMID: 28864002
  3. activates PDIA4 in placenta PMID: 28487027
  4. these findings suggest that classic signalling rather than trans-signalling is the mode by which IL-11 promotes gastric tumourigenesis. PMID: 28160627
  5. Results indicate that iterleukin-11 (IL11) is causal of Preeclampsia (PE) features in a mouse model and likely in women, and suggest potential of IL11 inhibition to rescue PE symptoms in women. PMID: 26655736
  6. IL-11-mediated STAT3 signaling not only reduces hepatocellular apoptosis, but also inhibits inflammatory responses. PMID: 25946003
  7. IL-1 signaling antagonizes IL-11/STAT3 mediated pathology and the genetic deletion of IL-1RT1 results in increased tumor burden. PMID: 25528766
  8. PGF2alpha inhibits adipocyte differentiation by means of an IL-11 mediated autocrine negative feedback loop, that acts via gp130 to block adipogenesis through the essential actions of the STAT1 transcription factor. PMID: 24519625
  9. Data indicate that colonic inflammation was more severe in mice fed an iron-supplemented compared with a control diet one week post-DSS treatment, with enhanced colonic IL-6 and IL-11 release and Stat3 phosphorylation. PMID: 24223168
  10. IL-11 reduced the production of reactive oxygen species. PMID: 23852503
  11. IL-11 therefore drives a pathway that enhances HSPC radioresistance and radiation-induced B-cell malignancies, but is normally attenuated by the inhibitory adaptor Lnk. PMID: 24297922
  12. IL-11 signaling may not play as significant a role in spinal cord injury as other glycoprotein gp130 cytokines. PMID: 22715999
  13. Data support the view that IL-11 is a key regulator of gastric damage acting to initiate chronic atrophic gastritis. PMID: 22180059
  14. Bovine lactoferrin administration prevented the progression of hepatic failure in human myofibroblasts and mice, and enhanced IL-11 and BMP2 expression in the small intestine. PMID: 21688123
  15. the mutant gp130 receptor protein from inflammatory hepatocellular adenoma is inhibited by an anti-gp130 antibody that specifically neutralizes interleukin 11 signaling PMID: 22523320
  16. IL-11 provides a functional link between oxidative stress and compensatory proliferation PMID: 22253262
  17. These findings imply a pathogenic role for IL-11 during the early phase of Mycobacterium tuberculosis-triggered disease in a genetically susceptible host. PMID: 21789190
  18. Mechanical stress activates Smad pathway through PKCdelta to enhance interleukin-11 gene transcription in osteoblasts. PMID: 20927330
  19. Addition of exogenous IL-11 protected against the lethal colitis in TLR2-deficient mice via STAT3 activation in intestinal epithelial cells. PMID: 20600022
  20. IL-11 attenuated cardiac fibrosis after MI through STAT3. Activation of the IL-11/glycoprotein 130/STAT3 axis may be a novel therapeutic strategy against cardiovascular diseases. PMID: 20100971
  21. These observations are consistent with the notion that mechanical stress stimulates IL-11 gene transcription via an enhanced DeltaFosB/JunD binding to the IL-11 gene promoter. PMID: 19665600
  22. IL-11 stimulates osteoclastic resorption in mouse calvariae that is independent of cell growth; partially dependent on prostaglandin biosynthesis; sensitive to inhibition by IL-4, IL-13 and OPG; and associated with enhanced expression of RANKL and OPG. PMID: 12110441
  23. Tumor-derived IL-11 may play a role in the depressed IL-12 production by macrophages, leading to the impaired immune functions observed during mammary tumorigenesis. PMID: 12527946
  24. The induction of hsp25 by IL-11 confers epithelial-specific cytoprotection that is independent of phosphorylation-dependent co-localization of hsp25 to F-actin, contributing to the protective effects of IL-11 in models of intestinal epithelial injury. PMID: 12730876
  25. interleukin-11 regulates adipocyte metabolism and gene expression PMID: 12791389
  26. Overexpression of interleukin 11 is associated with breast cancer metastasis to bone PMID: 12842083
  27. two tandem activating protein-1 (AP-1) sites that reside immediately upstream of TATA box play critical roles in IL-11 gene transcription PMID: 12929935
  28. IL-11 signaling is required for decidual-specific maturation of natural killer cells. PMID: 15499555
  29. heparin enhances IL-11-induced STAT3 activation and thus osteoclast formation, by a mechanism that is independent of STAT3 Ser-727 phosphorylation but that involves up-regulation of the MAPK pathway PMID: 16720575
  30. IL-11 signals through the Jak2/Stat3 pathway in decidual cells to stimulate the expression of alpha(2)-MG, a protease inhibitor essential for normal placentation in pregnancy. PMID: 16959875
  31. genetically define distinct roles of IL-6 and IL-11 in driving pathologic hematopoietic and lymphoid responses mediated by STAT3 hyperactivation PMID: 17082315
  32. Gnai2 knockout mice show significantly reduced intestinal IL-11 production. Suggest MAP kinases, PGE2 and cAMP mediated signaling involved. PMID: 17332478
  33. These results provide, at least in part, an explanation for the defective small decidua of mice lacking the Il11ra gene, and reveal for the first time that cyclin D3, CDKN1A (p21), and BIRC5 (Survivin) are targets of IL11 in the decidua. PMID: 17881769
  34. An increase in caspase-3 was seen in hyperoxia-exposed lungs of wild-type pups compared to IL-11 (+) pups PMID: 18214944
  35. Data identify IL-11 as a crucial cytokine promoting chronic gastric inflammation and associated tumorigenesis in gp130 receptor-eficient mice mediated by excessive activation of STAT3 and STAT1. PMID: 18431520
  36. Th2 and IL-13 responses can be regulated by interventions that manipulate IL-11 signaling in the murine lung. PMID: 18617680
  37. Increased gastric IL-11 alters expression of proliferative and cytoprotective genes and promotes pretumorigenic cellular changes PMID: 19121317
  38. IL-11 regulates inflammatory demyelination via a unique combination of immunoregulation and neuroprotection. PMID: 19734214

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-6 superfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*