Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

Code CSB-EP717533MOb1
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q64253
Relevance Involved in T-cell development.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Stem cell antigen 2 Thymic shared antigen 1
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Research Area Immunology
Source E.coli
Gene Names Ly6e
Expression Region 21-102aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 13.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in T-cell development
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Database Links

KEGG: mmu:17069

STRING: 10090.ENSMUSP00000056703

UniGene: Mm.788

Related Products

Ly6e Antibodies

Ly6e Antibodies for Mouse

Ly6e Antibodies for Mus musculus (Mouse)

Ly6e Proteins

Ly6e Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.