Home
Protein
Recombinant Protein
Recombinant Mouse Lymphocyte antigen 6E (Ly6e)

Recombinant Mouse Lymphocyte antigen 6E (Ly6e)

^{In Stock}

Code	CSB-YP717533MO
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Ly6e

Uniprot No.

Q64253

Research Area

Others

Alternative Names

Ly6e; Ly67; Sca-2; Tsa-1Lymphocyte antigen 6E; Ly-6E; Stem cell antigen 2; Thymic shared antigen 1; TSA-1

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

27-108aa

Target Protein Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

24.8kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of murine coronavirus, mouse hepatitis virus, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.

Gene References into Functions

Knocking down Ly6e greatly reduced SynA-induced cell fusion, thus suggesting that Ly6e is the sole receptor for SynA in vivo. PMID: 28679758
Sca-2 -- a signal transducer situated at the nexus of surface molecules regulating death receptor-mediated apoptosis in hepatoma PMID: 15170814

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor.

Tissue Specificity

Ubiquitously expressed in mouse adult tissues with maximal expression in the lung and the salivary gland. Expression is strikingly lower in the fetal tissues except for the placenta. Present in thymus where its expression is observed in immature thymocyte

Database Links

KEGG: mmu:17069

STRING: 10090.ENSMUSP00000056703

UniGene: Mm.788

Promotions