Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial

In Stock
Code CSB-EP013806HU
Abbreviation Recombinant Human MICA protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-307aa
Target Protein Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.
Gene References into Functions
  1. Results provide further evidence that genetic variants of MICA influence soluble MICA levels, and that Val mismatch at position 129 increases cytomegalovirus infection and kidney acute rejection risk during the first year post-pancreas-kidney transplantation . PMID: 30181474
  2. Role of MICA in different cancer types (review). PMID: 29635123
  3. The MICA A5.1 polymorphism was associated with a better CT morphologic response to chemotherapy and a reduced risk of relapse after Colorectal Liver Metastases resection. PMID: 29969766
  4. According to our analysis, three proteins, namely aristaless-like homeobox1 isoform X1 (ALX1), major histocompatibility complex polypeptide-related sequence A (MICA), and uncharacterized protein C14orf105 isoform X12 were found to be potential markers for Opisthorchis viverrini (OV)- infection, as they were predominantly found in all OV-infected groups PMID: 29936472
  5. MICA-129 val/val genotype, associated with higher levels of circulating sMICA, may influence disease susceptibility and associate with increased severity of rheumatoid arthritis in south Indian Tamils. PMID: 28752674
  6. rs12524487 in HLA-B/MICA was a genetic risk factor for Takayasu arteritis in a Chinese Han population and rs9366782 in this region was associated with ischemic brain disease in TA but not TA susceptibility. PMID: 28261975
  7. Here we discovered that an HCMV protein named UL148A whose role was hitherto unknown is required for evasion of NK cells. We demonstrate that UL148A-deficient HCMV strains are impaired in their ability to downregulate MICA expression. PMID: 29950412
  8. allele MICA*002:01/A9 and haplotype MICA*002:01-MICB*005:02 were negatively associated with respiratory syncytial virus respiratory tract infections. PMID: 28925058
  9. Levels of serum MICA were highly correlated to liver disease severity in chronic hepatitis C patients who carried the MICA rs738409 A allele. PMID: 28427234
  10. Strategies to block MICA-NKG2D interactions resulted in reductions in IFNgamma production. Depletion of monocytes in vivo resulted in decreased IFNgamma production by murine NK cells upon exposure to Ab-coated tumor cells PMID: 28724544
  11. A significant association was found between the Val allele and Val/Val genotype and the risk of breast cancer in Tunisian women. PMID: 28742417
  12. the present study revealed that DNA damagedependent MICA/B expression in insensitive cancer cells can be restored by chromatin relaxation via the HDAC/Suv39/G9a pathway. Collectively, manipulation of chromatin status by therapeutic cancer drugs may potentiate the antitumor effect by enhancing immune activation following radiotherapy and DNA damage-associated chemotherapy. PMID: 28677817
  13. Findings show that the efficient expression of cell-surface major histocompatibility class I-related chain molecule A (MICA) in the osteosarcoma cells requires asparagine (Asn)-N-linked glycosylation of MICA. PMID: 29491059
  14. Study identified the novel role of transcription factors GATA-2 and GATA-3 in suppressing MICA/B expression in HBV-infected human hepatoma cells. PMID: 27528231
  15. new MICA allelic variant, MICA*007:07, was identified in an individual of Mongol ethnicity in the Inner Mongolia Autonomous Region, northern China PMID: 28371368
  16. inhibition of BET proteins can enhance the expression of MICA, a ligand of the NKG2D receptor, in human MM cell lines and primary malignant plasma cells, rendering myeloma cells more efficient to activate NK cell degranulation PMID: 27903272
  17. results indicate that the polymorphism of rs2256318 in MICA may contribute to the etiology of Preterm birth through interfering with placental development. These findings need to be further validated in larger and multi-ethnic populations. PMID: 28864994
  18. The results of this study suggested that the MICB*009N allele might be a risk factor for SLE, whereas the MICB*014, MICA*010 and MICB*002 alleles were associated with reduced incidence of SLE in the study population. PMID: 29078849
  19. New truncated MICA isoforms exhibit a range of functions that may drive unexpected immune mechanisms and provide new tools for immunotherapy PMID: 27342847
  20. data reveal that MICA and PVR are directly regulated by human cytomegalovirus immediate early proteins, and this may be crucial for the onset of an early host antiviral response PMID: 27733551
  21. This demonstrates for the first time that MICA/B is more broadly expressed in normal tissue and that expression is mainly intracellular with only a small fraction appearing on the cell surface of some epithelia and tumour cells. PMID: 28334733
  22. selecting a MICA-matched donor significantly influences key clinical outcomes of HCT in which a marked reduction of GVHD is paramount. The tight linkage disequilibrium between MICA and HLA-B renders identifying a MICA-matched donor readily feasible in clinical practice. PMID: 27549307
  23. MICA-129 matching is relevant in unrelated hematopoietic stem cell transplantation. PMID: 27811019
  24. No evidence of an association between MICA*Del and nasopharyngeal carcinoma in the southern Chinese Han population. PMID: 27870115
  25. These findings identify the major histocompatibility complex-related MICA as an immunogenetic factor that may functionally influence anti-BK polyomavirus immune responses and infection outcomes. PMID: 27130430
  26. This study provided information on the distribution of MICA polymorphisms and linkage disequilibrium with HLA-B alleles in Brazilian renal-transplant candidates. A total of 19 MICA allele groups were identified. The most frequent allele groups were MICA*008 (21.6%), MICA*002 (17.0%) and MICA*004 (14.8%). The most common haplotypes were MICA*009-B*51 (7.8%), MICA*004-B*44 (6.06%) and MICA*002-B*35 (5.63%). PMID: 28419176
  27. MICA*A4 protects against ulcerative colitis, whereas MICA*A5.1 is associated with abscess formation and age of onset. PMID: 26940143
  28. MICA*012:05 differs from MICA*012:01 by a single synonymous C to T substitution at nucleotide position 269 in exon PMID: 27273902
  29. there is no obvious correlation between the MMP9 -1562 C/T SNP and the concentrations of circulating MICA/B in the breast cancer patients. PMID: 27026046
  30. Cirrhotic patients who carry MICA risk alleles and those without risk alleles but with high sMICA levels possessed the highest risk of HCC development once they failed antiviral therapy. PMID: 27998720
  31. High levels of serum MICA is associated with acute myocardial infarction. PMID: 27306684
  32. Findings shown here are important from an anthropologic perspective and will inform future studies of the potential role of MICA and MICB genes in allogeneic organ transplantation and HLA-linked disease association in populations of related ancestry. PMID: 27028549
  33. MICA was significantly associated with the epithelial-to-mesenchymal transition gene set in clear cell renal cell carcinoma PMID: 26349747
  34. Reversal of epigenetic silencing of MICA and MICB improves immune recognition and killing of Merkel cell carcinoma cells. PMID: 26902929
  35. Our meta-analysis confirmed MICA-A6 could be responsible for BD in three ethnic regions and should probably be treated as a risk factor for Behcet's disease. PMID: 26875668
  36. IFN-gamma rs2069727 and MICA rs2596542 polymorphisms may be related to the incidence of hepatocellular carcinoma. PMID: 26893439
  37. gastric cancer patients who have tumors with high expression of MICA are more likely to benefit from adjuvant chemotherapy, immunotherapy and gastrectomy PMID: 26607264
  38. Our results suggest that locally sustained expression of MICA and MICB in the tumor may contribute to the malignant progression of Gastric cancer(GC) and that expression of these ligands predicts an unfavorable prognosis in GC patients presenting large tumors. PMID: 26708143
  39. In South Tunisian population, MICA plays a disease modifying role, rather than being an important gene in the susceptibility for developing of uveitis. PMID: 25468490
  40. The reduced cell surface expression of NKG2D in response to engagement by MICA-129Met variants appeared to reduce the severity of acute graft-versus-host disease. PMID: 26483398
  41. Estrogen upregulates MICA/B expression in human non-small cell lung cancer through the regulation of ADAM17. PMID: 25363527
  42. This meta-analysis shows that the MICA-TM A6 allele and the MICA*009 allele are associated with BD susceptibility in various ethnic populations, and that MICA alleles are in strong linkage disequilibrium with HLA-B51 in BD. PMID: 26184953
  43. The importance of the functional MICA-129 polymorphism in the severity of left ventricular ejection fraction in Chronic Chagas heart disease was addressed. PMID: 26129751
  44. MICA polymorphisms do not appear to influence the development of ocular lesions in patients diagnosed with toxoplasmosis in this study population. PMID: 26672749
  45. The study investigates the link between Behcet's Disease and two specific HLA alleles associated with Behcet's Disease (HLA-A*26:01 and HLA-B*51:01) in terms of their binding affinity to the MICA. PMID: 26331842
  46. In conclusion DNT cell can significantly inhibit the growth of pancreatic carcinoma in vivo, and the mechanism may be involved in abnormal expressions of MICA and NKG2D. PMID: 26616050
  47. Further studies of the association between HBV replication and MICA induction should be conducted. PMID: 26212443
  48. In cervical adenocarcinoma (but not squamous cell carcinoma), low sMICA was positively related to recurrent disease, a higher FIGO stage and vaginal involvement. High sMICA levels were associated with better disease-free and disease-specific survival. PMID: 25871737
  49. Serum MICA levels were related to tumor pathology, TNM stage, and kidney neoplasm metastasis. PMID: 26125933
  50. High MICA expression is associated with Renal Cancer. PMID: 25987057

Show More

Hide All

Involvement in disease
Psoriasis 1 (PSORS1); Psoriatic arthritis (PSORAS)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm.
Protein Families
MHC class I family, MIC subfamily
Tissue Specificity
Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within t
Database Links

HGNC: 7090

OMIM: 177900

KEGG: hsa:100507436

UniGene: Hs.130838

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*