Recombinant Mouse Macrophage colony-stimulating factor 1 receptor (Csf1r), partial (Active)

In Stock
Code CSB-MP006044MO
Abbreviation Recombinant Mouse Csf1r protein, partial (Active)
MSDS
Size $114
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1(CSB-MP006043MO) at 2 μg/ml can bind Mouse Csf1r. The EC50 is 3.226-4.264 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1(CSB-MP006043MO) at 2 μg/mL can bind Mouse Csf1r. The EC50 is 3.226-4.264 ng/mL.
Target Names
Uniprot No.
Alternative Names
Macrophage colony-stimulating factor 1 receptor; CSF-1 receptor (CSF-1-R; CSF-1R; M-CSF-R) (EC:2.7.10.1) . EC:2.7.10.1 ; Proto-oncogene c-Fms; CD115; Csf1r; Csfmr, Fms
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
20-511aa
Target Protein Sequence
APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES
Mol. Weight
84.1 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CSF-1R orchestrates macrophage differentiation and survival, making its extracellular domain a critical target for interrogating myeloid cell biology and therapeutic intervention in tumor-associated macrophage reprogramming. This construct spans residues 20–511, capturing the complete ligand-binding architecture, and demonstrates quantified binding to recombinant mouse CSF-1 with an EC50 of 3.2–4.3 ng/mL in functional ELISA, providing a validated reagent for competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping. Mammalian expression ensures native glycosylation and disulfide patterning essential for physiological receptor conformation, supporting high-confidence data in surface plasmon resonance affinity characterization and biolayer interferometry kinetic studies. The protein meets purity and endotoxin criteria typical for ligand-receptor interaction platforms (>90% pure, <1.0 EU/μg), aligning with standards expected in small-molecule inhibitor screening and biologic drug discovery workflows targeting the CSF-1/CSF-1R axis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding, including the ERK1/2 and the JNK pathway. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor. In the central nervous system, may play a role in the development of microglia macrophages.
Gene References into Functions
  1. CSF1R-dependent macrophages have roles in control of the intestinal stem-cell niche PMID: 29593242
  2. Targeting MAMs by CSF1R blocking mAbs may be promising methods to (re)sensitize myeloma cells to chemotherapy. PMID: 28626216
  3. Findings indicate that colony stimulating factor-1 receptor (CSF1R) signalling regulates inflammation in the central and peripheral nervous system in amyotrophic lateral sclerosis (ALS), suggesting therapeutic targeting of CSF1R in this disease. PMID: 27174644
  4. These findings reveal a novel and functionally important role for EHD1 in governing CSF-1R signalling via regulation of anterograde transport of CSF-1R to the macrophage cell surface. PMID: 27224507
  5. Our findings thus demonstrate that microenvironmental alteration by CSF-1R blockade renders tumor cells more susceptible to receptor tyrosine kinase inhibition in a preclinical glioblastoma model, which may have important translational relevance PMID: 28759044
  6. CSF-1R role in the development of erythro-myeloid progenitor cells in the developing fetal liver PMID: 26235516
  7. analysis of CSF1R-deficient mice establishes a distinct role of CSF1R in fetal B-lymphopoiesis. PMID: 27207794
  8. this study shows that the iRhom2/ADAM17 pathway plays an important role in regulating CSF1R expression in the myeloid cell compartment at steady state, and in modulating development of monocytes/macrophages during their repopulation PMID: 27601030
  9. this study shows that macrophage maturation is accompanied by colony-stimulating factor 1hypomethylation, and illustrates for the first time the ability of protein kinase A to increase Csf1r DNA methylation PMID: 27353657
  10. Targeting of macrophages by either CSF1R signaling blockade or clodronate liposome-mediated cell killing has marked inhibitory effects on established leukemia. PMID: 26876171
  11. these data indicate that CSF-1R signalling is critical for maintaining cardiac tissue resident M2-polarized macrophage population PMID: 26407006
  12. Macropinosomes might be a central mechanism coupling CSF-1R signaling and macrophage growth. PMID: 25335894
  13. Results indicate that prostaglandin E2 activates colony-stimulating factor-1 receptor (CSF-1R) and synergizes with its signaling at mitogen-activated protein kinase ERK1/2 level in promoting macrophage migration. PMID: 25757564
  14. These findings indicate that PU.1-mediated upregulation of CSF-1R is a critical effector of MLL leukemogenesis. PMID: 25529853
  15. All-lymphoid progenitors ALPs express higher levels of CSF1R transcripts than their upstream precursors, but only limited cell-surface CSF1R expression. ADAM17 knockouts have more CSF1R surface expression. PMID: 25308957
  16. an ongoing requirement for CSF1R signaling in macrophage and OCL homeostasis but indicate that most effects of CSF1 and CSF1R mutations are due to effects on development. PMID: 24652541
  17. This study show that the adult brain has a remarkable capacity to regulate and renew its microglia population, through microglial progenitor cells, and that the CSF1R plays a crucial role in microglial tissue homeostasis. PMID: 24742461
  18. CSF-1 receptor-mediated differentiation of a new type of monocytic cell with B cell-stimulating activity. PMID: 24052571
  19. The data argue that key signalling responses to CSF-1 depend on the ability of the CSF-1R to signal from endosomes following its internalisation, thus adding an important spatiotemporal aspect to CSF-1R signalling. PMID: 22575736
  20. results identify TAMs as a promising therapeutic target for proneural gliomas and establish the translational potential of CSF-1R inhibition for GBM PMID: 24056773
  21. CSF-1R directly supports Paneth cell (PC) maturation and that in turn PCs fashion the intestinal stem cell niche. PMID: 23314290
  22. The data indicate that CSF-1R signaling plays an important role in colon homeostasis and stem cell gene expression. PMID: 23451116
  23. Fms-Intronic Regulatory Element is an orientation-specific transcribed enhancer elemen PMID: 23383005
  24. CSF1/CSF1R signaling is important in the recruitment of tumor-infiltrating myeloid cells that can limit the efficacy of radiotherapy PMID: 23418320
  25. M-CSF binding to its receptor, c-Fms, results in increased c-Fms activation in Nf1(+/) (-) osteoclast progenitors, mediating multiple gain-in-functions through the downstream effectors Erk1/2 and p90RSK. PMID: 23144792
  26. Colony-stimulating factor 1 receptor signaling in injured neurons facilitates their protection and survival. PMID: 23296467
  27. CSF-1R signaling controls the development of the macrophage lineage at a relatively late stage under steady state conditions PMID: 21727904
  28. The expression of CSF-1R in neurons could be up-regulated by ischemic injury in the central nervous system. PMID: 21141543
  29. ablation of the Csf1r gene in Nestin-positive neural progenitors led to a smaller brain size, an expanded neural progenitor pool and elevated cellular apoptosis in cortical forebrain PMID: 22542597
  30. Macrophage proliferation is regulated through CSF-1 receptor tyrosines 544, 559, and 807 PMID: 22375015
  31. p110delta-dependent translocation of exogenous CSF-1 to the nucleus-associated CSF-1Rs, correlating with a prominent role of p110delta in activation of the Rab5 GTPase, a key regulator of endocytic trafficking PMID: 22084313
  32. a structural and mechanistic consensus for the assembly of mouse CSF-1:CSF-1R complexes PMID: 22153499
  33. CSF-1R is required for the development of microglia, for a fully functional olfactory system and the maintenance of normal brain structure. PMID: 22046273
  34. CSF1R-expressing macrophages are crucial for epithelial cell death and adipocyte repopulation during mammary gland involution. PMID: 22129827
  35. Our data provide genetic and biochemical evidence that CSF-1R, through Gab2, utilizes different effectors at different stages of MNP development to promote their expansion PMID: 21930791
  36. Data demonstrate that PAX5 regulates Csf1r in B cells by reducing the frequency of binding of the basal transcription machinery to the promoter. PMID: 21549805
  37. TNF-alpha (in the presence of M-CSF) is capable of inducing osteoclastogenesis from bone marrow macrophages, and osteoclastogenesis is significantly stimulated by force application through the activation of c-Fms-mediated signaling PMID: 20803546
  38. CSF1R signaling is required only for the maturation and replacement of resident-type monocytes and tissue macrophages, and is not required for monocyte production or inflammatory function. PMID: 20682855
  39. Lnk binds to c-Fms and can blunt M-CSF stimulation PMID: 20571037
  40. c-Fms plays a central role in the pathogenesis of rheumatoid arthritis by mediating the differentiation and priming of monocyte lineage cells PMID: 20181277
  41. RT-PCR analyses of Csf1r mRNA revealed that mouse OCL use another promoter within this region, distinct from that used in placental trophoblasts, to generate an alternative 5'UTR. PMID: 20123678
  42. Accumulation of c-Cbl and rapid termination of colony-stimulating factor 1 receptor signaling in interferon consensus sequence binding protein-deficient bone marrow-derived macrophages PMID: 11964285
  43. transcription factor complex formation and chromatin fine structure alterations at the locus during maturation of myeloid precursor cells PMID: 12101129
  44. These observations correlate CSF-1R expression with changes in the growth and development of the normal and neoplastic prostate PMID: 12381783
  45. Fms and alpha(v)beta(3) collaborate in the osteoclastogenic process via shared activation of the ERK/c-Fos signaling pathway. PMID: 12618529
  46. correlation between gp130-dependent ERK MAP kinase signaling and c-fms gene activation PMID: 14749363
  47. Transfection into HC11 mammary epithelial cells with CSF1R mutated to express phe at the tyr-721 autophosphorylation site (HC11-CSF1R-721) creates a phenotype that lacks metastastic competence but maintains local invasiveness. PMID: 14767486
  48. dramatic bone defects in Csf1r(-/-) mice are caused by a deficiency of the osteoclast-mediated regulation of osteoblasts and that the osteoclast plays an important role in regulating osteoblastic bone formation during development PMID: 15312244
  49. Data show that in developing B cells, c-fms chromatin is silenced in distinct steps. PMID: 15483629
  50. CSF-1 receptor and the VEGFR-1 plays a predominant role not only in osteoclastogenesis but also in the maintenance of bone marrow functions. PMID: 16172397

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=The autophosphorylated receptor is ubiquitinated and internalized, leading to its degradation.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily
Tissue Specificity
Widely expressed.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*