Recombinant Mouse Myoglobin(Mb)

In Stock
Code CSB-YP013529MO
Product Type Recombinant Protein
Size US$2474Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P04247
Lead Time 3-7 business days
Relevance Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Research Area Cardiovascular
Source Yeast
Gene Names Mb
Protein Names Recommended name: Myoglobin
Expression Region 2-154aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 18.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Protein Families Globin family
Database Links

KEGG: mmu:17189

STRING: 10090.ENSMUSP00000019037

UniGene: Mm.404074

Related Products

Mb Antibodies

Mb Antibodies for Mus musculus (Mouse)

Mb Proteins

Mb Proteins for Mus musculus (Mouse)

Mb ELISA Kit

Mb ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.