Recombinant Mouse Nuclear factor erythroid 2-related factor 2 (Nfe2l2), partial

Code CSB-MP726674MO1
Abbreviation Recombinant Mouse Nfe2l2 protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Nuclear factor, erythroid derived 2, like 2
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-84aa
Target Protein Sequence
MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQEKAFFAQFQLDEETGEFL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.9 kDa
Protein Length
Partial
Tag Info
N-terminal mFc2a-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor that plays a key role in the response to oxidative stress: binds to antioxidant response (ARE) elements present in the promoter region of many cytoprotective genes, such as phase 2 detoxifying enzymes, and promotes their expression, thereby neutralizing reactive electrophiles. In normal conditions, ubiquitinated and degraded in the cytoplasm by the BCR(KEAP1) complex. In response to oxidative stress, electrophile metabolites inhibit activity of the BCR(KEAP1) complex, promoting nuclear accumulation of NFE2L2/NRF2, heterodimerization with one of the small Maf proteins and binding to ARE elements of cytoprotective target genes. The NFE2L2/NRF2 pathway is also activated in response to selective autophagy: autophagy promotes interaction between KEAP1 and SQSTM1/p62 and subsequent inactivation of the BCR(KEAP1) complex, leading to NFE2L2/NRF2 nuclear accumulation and expression of cytoprotective genes. May also be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region. Plays also an important role in the regulation of the innate immune response. It is a critical regulator of the innate immune response and survival during sepsis by maintaining redox homeostasis and restraint of the dysregulation of proinflammatory signaling pathways like MyD88-dependent and -independent and TNF-alpha signaling. Suppresses macrophage inflammatory response by blocking proinflammatory cytokine transcription and the induction of IL6. Binds to the proximity of proinflammatory genes in macrophages and inhibits RNA Pol II recruitment. The inhibition is independent of the Nrf2-binding motif and reactive oxygen species level. Represses antiviral cytosolic DNA sensing by suppressing the expression of the adapter protein STING1 and decreasing responsiveness to STING1 agonists while increasing susceptibility to infection with DNA viruses.
Gene References into Functions
  1. modulation of NF-E2-related factor 2, so as to tilt the balance toward angiogenesis, representing a therapeutic strategy for hypoxia or ischemia disorders such as stroke PMID: 29373803
  2. It has been shown that genetic ablation of Nrf2 abolishes an adaptive muscle NQO1 activity and catalase induction. PMID: 29402993
  3. Study indicated that, by increasing the expression of NRF2, the mitophagy induced by melatonin provided protection against brain injury post-SAH. PMID: 30210141
  4. Dopamine D5 receptor may play an important role in the preservation of normal heart function by inhibiting the production of reactive oxygen species, via inhibition of NADPH oxidase, Nrf2 degradation, and ERK1/2/JNK pathways. PMID: 30153650
  5. Nrf2 signaling rescues oligodendrocytes damaged by dysfunctional mitochondria. PMID: 30140996
  6. The Nrf2-ARE signaling pathway plays a vital role in preventing aGVHD in an HSCT mouse model by regulating the expression of the downstream antioxidant genes NQO1 and HO-1 and by inhibiting the local inflammatory reaction. PMID: 30148822
  7. Nrf2/Keap1 system regulates VSMC apoptosis during neointimal formation, thereby inhibiting neointimal hyperplasia after a vascular injury. PMID: 27198574
  8. H2AX has a physiologic function in mediating influences of oxidative stress on NRF2-transcriptional targets and behavior PMID: 29670103
  9. disruption of PTEN resulted in steatohepatitis, fibrosis and caused hepatic induction of the Nrf2-dependent antioxidant system at least in part due to elevation of p62 PMID: 29799837
  10. NRF2 inhibition is effective against the progression of chemically and spontaneously induced tumors. PMID: 28976703
  11. Ori might exhibit a protective role against H2O2-stimulated oxidative damage by the induction of HO-1 expression through the activation of the JNK- and PI3K/AKT-Nrf2 signaling pathways. PMID: 29959995
  12. Renal tubular deletion of Keap1 promotes nephrogenic diabetes insipidus features, confirming that Nrf2 activation in developing tubular cells causes a water reabsorption defect. PMID: 28233855
  13. These results indicate that loss of NRF2 activity critically worsens the inflammatory response to proteinopathy by anticipating onset and worsening progression of neuropathological cues. PMID: 30029164
  14. the KAT4 promoter was significantly activated by the transcriptional factors, NFE2related factor 2 and peroxisome proliferatoractivated receptor coactivator 1beta, which are targets of Syvn1induced degradation PMID: 29916549
  15. By inhibiting binding of Keap1 to Nrf2. PMID: 30021365
  16. Our data show reduced muscle mass and contractile force generation in old Nrf2-/- mice compared to age-matched wildtype mice associated with reduced mitochondrial oxygen consumption, increased mitochondrial ROS production, increased protein nitrosylation, cellular redox dysregulation, and reduced acetylcholine receptor expression. PMID: 29673700
  17. Keap1-null mice showed that differentiation of both osteoclasts and osteoblasts was attenuated, showing that impaired differentiation of osteoblasts rather than osteoclasts is responsible for bone hypoplasia caused by Nrf2 hyperactivation. PMID: 29542224
  18. Involved in the Nrf2/HO-1 pathway. PMID: 29730008
  19. these data suggest that alleviation of the sustained mitochondrial dysfunction and oxidative stress through co-modulation of NRF2 and PINK1 may be in charge of restoration of the cognitive impairments in a mouse model of high-LET carbon ion irradiation PMID: 29689442
  20. Here, the authors demonstrate that Tim-3 inhibits macrophage phagocytosis of Listeria monocytogenes by inhibiting the nuclear erythroid 2-related factor 2 (Nrf2) signaling pathway and increases bacterial burden. PMID: 28205579
  21. these studies are the first to demonstrate that Brain ischemic preconditioning protects the blood-brain barrier against ischemic injury by generation of endogenous electrophiles and activation of the Nrf2 pathway through inhibition of Keap1- and GSK3beta-dependent Nrf2 degradation. PMID: 29775963
  22. Thus, Nrf2 could be a critical factor for gene-environment interactions that may determine susceptibility to preterm birth. PMID: 28071748
  23. Our findings demonstrate that reversal of methionine oxidation is required for maintenance of cellular homeostasis in the absence of increased oxidative stress. These data provide the first link between autophagy and activation of Nrf2 in the setting of MsrA deletion PMID: 29649787
  24. Studied effect of Sargassum horneri (Turner) C. Agardh ethanol extract (SHE) on inflammation induced by fine dust in RAW 264.7 cells. Results suggest SHE protects the cells from oxidative stress in part by activating the nuclear factor erythroid derived 2 like 2 /heme oxygenase 1 (Nrf2/HO-1) signal pathway. PMID: 30200963
  25. Curcumin effects on TBI are associated with the activation the Nrf2 pathway. PMID: 29571711
  26. these results suggest that Nrf2 plays a central role in the prevention of Ang II-induced cardiomyopathy, and SFN prevents Ang II-induced cardiomyopathy partially via the Akt/GSK-3beta/Fyn-mediated Nrf2 activation. PMID: 29353218
  27. Me-Pa toxicity alters Ogg1 and Nrf2 promoter methylation. PMID: 29540303
  28. these results suggested that trehalose can function as a novel activator of the p62-Keap1/Nrf2 pathway, in addition to inducing autophagy. Therefore, trehalose may be useful to treat many chronic diseases involving oxidative stress and dysfunction of autophagy. PMID: 29241092
  29. It is an anti-inflammatory factor. PMID: 29754504
  30. Nrf2 regulation of autophagy-related genes likely plays a greater role in mediating the clearance of tau as an organism ages. PMID: 29304346
  31. findings provide the possible mechanism of the anti-neuroinflammatory properties of Petatewalide B that result from beneficial responses in the AMPK/Nrf2-signaling pathway. PMID: 29433360
  32. opposes transcriptional upregulation of proinflammatory cytokine genes PMID: 27211851
  33. exercise training inhibited nuclear factor kappa-B (NF-kappaB) expression induced by WPS and increased that of nuclear factor erythroid 2-related factor 2 (Nrf2). Findings suggest that exercise training significantly mitigated WPS-induced increase in airway resistance, inflammation, oxidative stress, and DNA damage via mechanisms that include inhibiting NF-kappaB and activating Nrf2 signalling pathways. PMID: 29692875
  34. fenofibrate attenuates oxidative stress and neuroinflammation in diabetic retinas, which is at least partially through modulating Nrf2 expression and NLRP3 inflammasome activation PMID: 29264825
  35. resveratrol prevents DM-induced cardiomyopathy, in part, by increasing Nrf2 expression and transcriptional activity. PMID: 29721501
  36. Plumbagin improves cognitive function in STZ induced mouse model of AD. PMID: 29501041
  37. Nrf2 can help prevent acute respiratory distress syndrome progression by promoting M2 polarization of macrophages. PMID: 29684352
  38. the present findings suggested that artesunate may exert protective effects against cerebral ischemia/reperfusion injury through the suppression of oxidative and inflammatory processes, via activating Nrf2 and downregulating ROSdependent p38 MAPK in mice. PMID: 29512760
  39. Downregulation of Nrf2 suppressed the Nrf2/ARE pathway, activated oxidative stress and neuroinflammation, and accelerated cognitive impairment in SAMP8 mice. Downregulation of Nrf2 accelerates the aging process through neuroinflammation and synaptic plasticity. PMID: 29474348
  40. Authors had found that RTA-408 could strengthen the total antioxidant capacity by increasing Nrf2 nuclear translocation and subsequently increased Nrf2 downstream GSH-related antioxidant gene expression and activity. PMID: 29435098
  41. n-propargyl caffeamide (PACA) attenuated LPS-induced NF-kB activation while activated Nrf2/HO-1 pathway. HO-1 inhibitor SnPP attenuated the effects of PACA on iNOS expression in LPS-challenged macrophages, possibly by regulating the cross-talk between HO-1 and NF-kB pathways. PMID: 29996121
  42. Deletion of both p62/Sqstm1 and Nrf2 genes spontaneously leads to the development of NASH. PMID: 29276215
  43. StA induced ERK phosphorylation-mediated Nrf2 activation, which contributed to its anti-inflammation and anti-oxidation. PMID: 29953988
  44. In vivo, activation of Nrf2 in fibroblasts promoted re-epithelialization of skin wounds, but also skin tumorigenesis. Activated Nrf2 qualifies as a marker of the cancer-associated fibroblast phenotype. PMID: 30016619
  45. We identified that Nrf2 activation inhibited NLRP3 inflammasome expression and subsequent IL-1beta generation. Furthermore, the activation of NLRP3 inflammasome was sensitive to the reactive oxygen species (ROS) level and Nrf2 could decrease the production of ROS. PMID: 28956063
  46. Data (including data from studies using tissues/cells from transgenic mice) suggest that ChREBPalpha up-regulates expression and activity of Nrf2, initiating mitochondrial biogenesis in beta-cells; induction of Nrf2 is required for ChREBPalpha-mediated effects and for glucose-stimulated beta-cell proliferation. [ChREBP = carbohydrate-responsive element-binding protein] PMID: 29764859
  47. Nrf2 deficiency promoted Th17 differentiation and function during Lupus nephritis development. PMID: 27941837
  48. Data suggest a clear link between Nrf2 and AD-mediated cognitive decline and further strengthen the connection between Nrf2 and AD. PMID: 29036636
  49. These results suggested that schisandrin A has a protective effect against LPS-induced inflammatory and oxidative responses in RAW 264.7 cells by inhibiting the NF-kappaB, MAPK and PI3K/Akt pathways; these effects are mediated, at least in part, by the activation of the Nrf2/HO-1 pathway PMID: 29115385
  50. Nrf2-null mice displayed high levels of oxidative stress and were inherently vulnerable to depression, but this phenotype was reversed by treatment with antioxidants. Results reveal a novel role for BDNF in controlling redox homeostasis and provide a mechanistic explanation for post-stress vulnerability to depression while suggesting ways to reverse it. PMID: 27646262

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Nucleus.
Protein Families
BZIP family, CNC subfamily
Tissue Specificity
Widely expressed. Highest expression in liver, skeletal muscle, luminal cells of the stomach and intestine, lining of the bronchi and alveoli, and in renal tubules; followed by heart, spleen, testis and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*