Recombinant Mouse Protein-lysine 6-oxidase (Lox)

In Stock
Code CSB-BP013038MO
Abbreviation Recombinant Mouse Lox protein
MSDS
Size $317
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Lox; Rrg; Protein-lysine 6-oxidase; EC 1.4.3.13; Lysyl oxidase; Ras excision protein) [Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form]
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
163-411aa
Target Protein Sequence
DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
Gene References into Functions
  1. LOX over-expression in vascular smooth muscle cells was associated with a change in the structure of collagen and elastin fibres; LOX could constitute a novel source of oxidative stress that might participate in elastin changes and contribute to vascular remodelling PMID: 28624291
  2. LOX up-regulation is associated with enhanced oxidative stress that promotes p38MAPK activation, elastin structural alterations, and vascular stiffness. PMID: 28010122
  3. These results suggest that LOX has the ability to induce RANKL expression on stromal cells; however, it fails to substitute for RANKL in osteoclastogenesis. PMID: 27606829
  4. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. PMID: 28106301
  5. Data show that LOX-PP enhances adipogenesis at least partially through inhibition of FGF-2 receptor signaling. PMID: 28452589
  6. LOX targeting reduces peritoneal fibrosis. PMID: 28800626
  7. Absence of lysyl oxidase (Lox) causes thoracic aortic aneurysms. The aortic mechanical behavior of Lox(-/-) mice is consistent with reduced elastin and collagen cross-linking but demonstrates vascular location-specific differences. Lox(-/-) aortas show upregulation of matrix remodeling genes and location-specific differential expression of other matrix and smooth muscle cell gene sets. PMID: 28550176
  8. Findings from this study indicate that preventing LOX overexpression may be protective against high glucose-induced apoptosis in retinal vascular cells associated with diabetic retinopathy. PMID: 28538980
  9. LOX family members contribute significantly to the detrimental effects of cardiac remodelling, highlighting LOX inhibition as a potential therapeutic strategy for post-infarction recovery PMID: 26260798
  10. Findings suggest that the lysyl oxidase (LOX)-mediated organization of collagen fibers in the extracellular matrix is an important regulator of osteoblastogenesis. PMID: 26497171
  11. The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites. PMID: 26893379
  12. Data suggest of pharmacologic targeting of lysyl oxidase (LOX) pathway to inhibit liver fibrosis and promote its resolution. PMID: 26700732
  13. Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase. PMID: 26437801
  14. CTR1, ATP7A, and lysyl oxidase were upregulated in the lung tissues and pulmonary arteries of mice with hypoxia-induced pulmonary hypertension and pulmonary arterial smooth muscle cells. PMID: 24614111
  15. Inhibition of tissue transglutaminase resulted in a reduced rate of compaction compared to controls during early remodeling (up to 2 days). In contrast, inhibition of lysyl oxidase did not alter the early compaction. PMID: 25924936
  16. decreased expression of cross-linking enzymes (LOXs) and increased expression of ECM-degrading proteinases (MMP-1, 2, 3) might be of great contribution to poor healing ability of PCL ligament PMID: 25416119
  17. LOX is indispensable for the progression of BLM-induced experimental lung fibrosis by aggravating the inflammatory response and subsequent fibrosis process after lung injury. PMID: 25348956
  18. LOX and LOXL2 may play an important role in the pathogenesis of AMD. Targeting LOXL2 could have a broader efficacy than targeting LOX, by reducing angiogenesis and inflammation, as well as fibrosis. PMID: 26258612
  19. LOX plays a critical role in vascular remodelling PMID: 24990180
  20. LOX is a novel regulator of NFATc1-driven osteoclastogenesis, independent of RANK ligand, which disrupts normal bone homeostasis leading to the formation of focal pre-metastatic lesions PMID: 26017313
  21. DDR2 binding and activation were disrupted by collagen glycation, pointing to a mechanism for the diminished levels of lysyl oxidase and consequently low lysyl oxidase-derived cross-links in diabetic bone. PMID: 24120383
  22. miR-29b down-regulates HSP47 and LOX expression. PMID: 24650661
  23. lysyl oxidase activity participates in primary tumor growth by directly impacting the senescence stability. PMID: 24113189
  24. Stromally derived lysyl oxidase promotes metastasis of transforming growth factor-beta-deficient mouse mammary carcinomas. PMID: 23856251
  25. Silencing of lysyl oxidase in BMP4-treated C3H10T1/2 cells induced a mesenchymal-epithelial transition (MET)-like response associated with the repression of mesenchymal markers, induction of epithelial markers and decreased cell migration. PMID: 23395997
  26. LOX expression is strongly upregulated in Staphylococcus aureus infections in vivo. PMID: 23649089
  27. Suggest a causal relationship between LOX downregulation and aortic stiffening in obesity. PMID: 23413430
  28. Stress urinary incontinence following vaginal trauma involves over-expression of LOX and decreased synthesis of extracellular matrix components or increased proteolysis in the urethra. PMID: 22572217
  29. Data show that lysyl oxidase LOX staining intensity was intermittent in the ligamentum flavum over from stages E15 to 2 years, and stages that stained intensely were E16 and E18, and P7 through P21. PMID: 22685574
  30. the lysyl oxidase (Lox) protein is degraded through lysosome and accumulated in the Vps18 deficient cerebellum but not in cerebral cortices. PMID: 22699122
  31. Lysyl oxidase activity is essential to generate optimal chemotactic sensitivity of cells to chemoattractants by oxidizing specific cell surface proteins, such as platetlet-derived growth factor receptor (PDGFR)-beta. PMID: 21509606
  32. These results indicate that proLOX could be processed by two different mechanisms producing two forms of active LOX. PMID: 21591931
  33. LOX-PP is shown to negatively regulate pro-oncogenic beta-catenin signaling in lung cancer cells. PMID: 21690299
  34. LOX is a potential mediator that couples mechanotransduction to oncogenic signaling by TGF-beta1 and measures capable of inactivating LOX function may prove effective in diminishing breast cancer progression stimulated by TGF-beta1. PMID: 21532881
  35. in vitro and in vivo data support a novel role for LOX in regulating MK expansion by PDGF-BB and suggest LOX as a new potential therapeutic target for myelofibrosis PMID: 21665949
  36. Data show that CA9, GLUT1 and LOX mRNA levels were equally and strongly correlated to hypoxic extent in FaDudd, and the same profile was observed for CA9 and GLUT1, but not LOX, in SCCVII tumors. PMID: 21306648
  37. LKB1 loss of function promotes lung cancer malignancy through remodeling of extracellular matrix microenvironment, and identify LOX as a potential target for disease treatment in lung cancer patients. PMID: 20956321
  38. Suggest that uric acid increases fibronectin synthesis both in vivo and in vitro via urate transporters through upregulation of lysyl oxidase expression. PMID: 20484295
  39. periostin supported BMP-1-mediated proteolytic activation of LOX on the extracellular matrix, which promoted collagen cross-linking. PMID: 20181949
  40. LOX has a novel function in resolving inflammation by reducing MCP-1 in abdominal aortic aneurysm PMID: 19683237
  41. Lysyl oxidase has a role in oxidizing basic fibroblast growth factor and inactivating its mitogenic potential PMID: 12461785
  42. lysyl oxidase appears critical during embryogenesis for structural stability of the aorta and diaphragm and connective tissue development PMID: 12473682
  43. Lox expression is prominent during embryonic cardiovascular development. PMID: 12524683
  44. Anti-oncogenic effects of lysyl oxidase on ras-mediated transformation are due to its ability to inhibit signaling pathways that lead to activation of NF-kappa B PMID: 12640111
  45. FGF-2 autocrine pathway inhibits lysyl oxidase transcription in the tumorigenic-transformed RS485 cell line. PMID: 12788924
  46. The LOX expressed in the choroid plexus, blood vessel walls, brain matrix, and neurons of normal mice. And LOX gene expression was enhanced in the neurons of the spinal cord, brain stem, cortex, caudoputamen and cerebellum in mSOD1 mice. PMID: 14741400
  47. collagen deposition and lysyl oxidase are regulated by tumor necrosis factor-alpha in osteoblasts PMID: 15138266
  48. lysyl oxidase functions to inhibit ras-dependent cell transformation PMID: 15277520
  49. Results compare the immunohistochemical localization of lysyl oxidase and lysyl oxidase-like in various tissues from normal, young adult mice. PMID: 15609098
  50. the FN matrix may provide specific microenvironments to regulate LOX catalytic activity PMID: 15843371

Show More

Hide All

Subcellular Location
Secreted. Secreted, extracellular space.
Protein Families
Lysyl oxidase family
Tissue Specificity
Expressed in aorta (at protein level). Expressed in embryonic, juvenil and adult aorta.
Database Links

KEGG: mmu:16948

STRING: 10090.ENSMUSP00000025409

UniGene: Mm.172

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*